KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1760Help
Entry
Rru_A1760         CDS       T00310                                 

Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Brite
Enzymes [BR:rru01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Rru_A1760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 3835182
NCBI-ProteinID: YP_426847
UniProt: Q2RTI5
LinkDB All DBs
Position
2053286..2053969
Genome map
AA seq 227 aa AA seqDB search
MAYIACEPAIGFPDDRESGDTNNLGEIDMAFELPPLPFAKEALEPHISAKTFEFHHGKHH
NAYVTTLNSLIKDTPLADKSLEDIITTVAGDAAKTPVFNNAAQVWNHTFFWNSLSPTGGG
QPTGAAKEAIDGAFGSLDAFKEQFKQAGVTQFGSGWAWLVVDGGKLSIAKTPNAELPLTK
GQTAVLTCDVWEHAYYLDYQNRRPDFLQTFLDHLVNWDFLAANLAKA
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatatcgcctgcgaacccgccatcggttttcccgacgatcgggagagcggcgac
acaaacaatctaggagagatcgacatggctttcgaactgccgcccctgcccttcgccaag
gaggccctggagccgcatatttcagccaagactttcgaatttcatcatggcaagcatcat
aacgcctatgtcaccaccctcaattcgttgatcaaagatacccccctggccgataagtcg
cttgaggatatcattaccaccgtggccggcgacgccgccaagaccccggtcttcaacaat
gccgcccaggtgtggaaccacacgtttttctggaacagcctgtcgccgaccggcggcggc
cagccgaccggcgcggccaaagaggcgatcgacggcgccttcggctcgctcgacgccttc
aaggagcagttcaagcaggccggcgtcacccaattcggcagtggctgggcttggctggtg
gtggacggcggcaagctgtcgatcgccaagacgcccaatgccgaattgcccctgaccaag
ggccagaccgccgttctgacctgcgatgtctgggagcatgcctattatctggattaccag
aatcgccgccccgacttcctgcagaccttcctggatcacctcgtgaactgggacttcctg
gcggccaatctggccaaggcctga

DBGET integrated database retrieval system