KEGG   Rhodospirillum rubrum ATCC 11170: Rru_A1879Help
Entry
Rru_A1879         CDS       T00310                                 

Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rru  Rhodospirillum rubrum ATCC 11170
Pathway
rru00010  Glycolysis / Gluconeogenesis
rru00020  Citrate cycle (TCA cycle)
rru00620  Pyruvate metabolism
rru01100  Metabolic pathways
rru01110  Biosynthesis of secondary metabolites
rru01120  Microbial metabolism in diverse environments
rru01130  Biosynthesis of antibiotics
rru01200  Carbon metabolism
Module
rru_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rru_A1879
   00020 Citrate cycle (TCA cycle)
    Rru_A1879
   00620 Pyruvate metabolism
    Rru_A1879
Enzymes [BR:rru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Rru_A1879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N
Motif
Other DBs
NCBI-GeneID: 3835303
NCBI-ProteinID: YP_426966
UniProt: Q2RT66
LinkDB All DBs
Position
complement(2176545..2177867)
Genome map
AA seq 440 aa AA seqDB search
MPIEILMPALSPTMEEGTLAKWLKKEGDPIAAGDVIAEIETDKATMEFEATDEGVLGKIL
VADGTAGIKVNQPIGILLEEGEDASALVQAAPAKAPDAPAKAAPEPAPVAAASQSDAAPA
PAAAAPKRAAGERLFASPLARRIAAAEGLDLGALQGSGPHGRIVRRDVEAALAAGTGKTA
EKAVAAPVAPAAPPQAVAAAAPKPVALPDAPHTKVANTSMRKIIARRLTESKQTVPHFYL
TVDCKIDALLDLRKSLNARAEKRGDGVKLSVNDLIIKAVALALRKVPAANASWSDEAIVL
WSDVDISVAVATPGGLITPIVRKADQKGLATISAEMKDLATRARDGKLKPEEFQGGGFSI
SNLGMYGIREFAAIINPPQGCILAVGAGEQRPVVEAGALAIATVMSCTLSVDHRVVDGAV
GAEFLSAFKILIEDPMAMML
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcgagatcctgatgcccgcgctctctccaacgatggaggagggaaccctggcc
aagtggctgaagaaggagggcgatcccatcgccgccggcgatgtcatcgccgaaatcgaa
accgataaggcgacgatggaattcgaagccaccgacgagggcgttcttggcaagatcctg
gtcgccgacggcaccgccggcatcaaggtcaaccagccgatcggcattttgcttgaggaa
ggcgaggacgccagcgccctggtccaggccgctccggccaaagccccggatgccccggcc
aaggccgcgcccgagccggcccctgtcgccgcggcgtcccaaagcgacgccgcgcccgcc
ccggcggcggccgcgcccaagcgggcggccggtgaacggctgttcgccagtccgctggcc
cggcgcatcgccgccgccgaaggccttgatctgggagcccttcaaggcagcggcccccat
ggccgcatcgtgcgccgcgatgtcgaggcggctttggccgccggcaccggtaaaacggcc
gaaaaggcggttgccgcgccggtcgctcccgccgctccgccgcaagcggtcgccgccgcc
gcgcccaagcccgtggccttgcccgacgcgccccataccaaggtggccaatacgtcgatg
cgcaagatcatcgcccggcgcctgaccgagtccaagcagacggttccccatttctacctg
accgtcgattgcaagatcgacgccctgcttgatctgcgtaagagcttgaacgcccgggcc
gaaaagcgcggcgacggggtcaagctgtcggtcaacgacctgatcatcaaggccgtcgcc
ctcgccctgcgcaaggtgcccgccgccaacgcctcgtggagcgacgaggcgatcgtgctg
tggagcgatgtcgatatctcggttgccgtcgccaccccgggcgggttgatcaccccgatc
gtccgcaaggccgaccagaaggggctggcgacgatctcggccgagatgaaggatctggcg
acgcgggcccgcgacggcaagctcaagcccgaggagttccagggcggcggcttcagcatc
tccaaccttggcatgtacggcatccgcgagttcgccgcgatcatcaatccgccccagggc
tgcatcctggccgtcggcgccggcgaacaacgcccggtggtcgaggccggagccttggcg
atcgccacggtgatgagttgcacgctctcggttgaccatcgggtggtcgatggcgcggtc
ggcgccgaattccttagcgccttcaagatcttgatcgaagatcccatggcgatgatgctc
tag

DBGET integrated database retrieval system