KEGG   Rathayibacter rathayi: C1O28_14460Help
Entry
C1O28_14460       CDS       T05845                                 

Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
rry  Rathayibacter rathayi
Brite
KEGG Orthology (KO) [BR:rry00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C1O28_14460
Enzymes [BR:rry01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     C1O28_14460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 Shikimate_DH 2-Hacid_dh_C Methyltransf_25 Sacchrp_dh_NADP NAD_binding_7 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AZZ50246
UniProt: A0A2S5XY92
LinkDB All DBs
Position
3006138..3007178
Genome map
AA seq 346 aa AA seqDB search
MPLSLPASTTRVVVHAAGDLRVEEAPLPARGPSDALVAVAYGGICGSDLHYWTHGAAGES
ILREPLTLGHEVVGTVVEAAADGTGPATGTAVAVHPATAHGEWPDGRPNLATEGTYLGSA
ARMPHTQGAFARHAVLPARMLRQLPPGLWLREAALAEPASVAWHAVSRAGAVSGRRALVI
GSGPIGALIVAVLKRAGAAEIVAVDLAEEPLAIARAVGATRTIRATDADAIAEVAADVVF
ESSGSPRGLMSAVRGAARGCTVVMVGLLPSGEQPALISLAITRELRLIGSFRFVDELDEV
LAALADGSLEVEPVVTQVLPLERAVEAFELARDASRSSKVLLDFTS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcccctctccctccccgcctcgaccacccgagtcgtcgtgcacgccgccggcgacctc
cgcgtcgaggaggcgccgttgccggcgcgcggcccttccgacgcccttgtcgccgtcgcc
tacggtgggatctgcggttccgatctgcactactggacgcacggcgcggcgggcgagtcg
atcctccgcgagccgctgaccctcggccacgaggtcgtcggaacggtcgtcgaggccgcc
gccgacggcaccggtcccgcgaccggcacagccgtcgccgtccaccccgcgaccgcccac
ggcgagtggcccgacgggcgccccaacctcgccaccgagggcacctacctcggcagcgcc
gcgcggatgccgcacactcagggggcgttcgcccggcacgcggtcctgccggctcggatg
ctccgccagctgcccccggggctgtggctccgagaggcggcgctcgcggagccggcgagt
gtcgcctggcacgcggtgtcgcgggcgggcgcggtgtccggacggcgcgcgctggtgatc
ggcagcggcccgatcggagcgctgatcgtcgcggtcctcaagcgggccggtgcagccgag
atcgtcgcggtcgatctcgcggaggagccgctcgccatcgcccgcgcggtcggagcgacc
cggacgatccgcgcgaccgacgccgacgcgatcgcggaggtcgccgccgatgtcgtcttc
gagtcctcgggtagcccgcgcgggttgatgtcggccgtccgcggcgcggcgcgcggctgt
accgtcgtcatggtcgggctcctgccctcgggtgagcagccggcgctgatctcgctcgcg
atcacgcgggagctgcgcctcatcggctccttccgcttcgtcgacgaactcgacgaggtg
ctggcggcgctcgccgacggcagcctcgaggtggagccggtggtcacccaggtgctgccg
ctggagcgcgcagtcgaggccttcgagctcgcccgcgatgcctcgcgctcgagcaaggtg
ctgctcgacttcacctcctga

DBGET integrated database retrieval system