KEGG   Rhodococcus ruber: CS378_04100Help
Entry
CS378_04100       CDS       T05142                                 

Definition
(GenBank) polyketide synthase
Organism
rrz  Rhodococcus ruber
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR Ketoacyl-synt_C PS-DH KAsynt_C_assoc PP-binding adh_short Epimerase Thiolase_N Docking Polysacc_synt_2 GDP_Man_Dehyd NmrA 3Beta_HSD NAD_binding_4 Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ATQ27993
LinkDB All DBs
Position
complement(911286..921836)
Genome map
AA seq 3516 aa AA seqDB search
MADDAKLLDYLKRVTAELYQAREKLREVEGVSREPIAVVGMGCRFPGGVRSPQDLWHLVE
SGTETVAAFPADRGWEAADLYDPTGRQAGRTYTVHGSFLDDAAGFDPEVFGISPREALAM
DPQQRLLLETSWETFEHAGIDPRSVHGRQIGVFTGLSGIDYSARAGGAPPEELAGYFITG
TAMSVASGRVAYSFGLNGPAITVDTACSSSLVSVHLAMQALRHGECELALAGGATVMSTP
AVFVEFSRQRGLARDGRCKAFAAAADGTAWGEGVAILALERLSDAQRNDHRILAVVRGSA
VNQDGASNGLTAPNKQAQERVIRQALADAGLGPADVDAVEAHGTGTTLGDPIEASALLAG
YGRDRPPDRPLWLGSVKSNLGHTQAAAGVAGVIKMIMAMRHGVLPKTLHVDRPTPHVDWT
AGSVSLLTENREWPATDRPRRAAVSSFGISGTNAHVVLEQPAPPPDAAPPEGTDGSDDVV
AWFVSGHTEPALRAQAHRLRDYVAGHPELTPAQVAGPLLTSRATFHHRAAVLGADPRALL
SGLDALGRGAPDPGVITGVAVEAGDRPVFVFPGQGAQWVGMATALLESSPLFADSLRECA
DALAPHTEFALLDVLRDRDPSALDRADVVQPALFAVMVGLARLWQAHGVEPAAVVGHSQG
EIAAAHVAGALTLPDAALAVAARSRVITESARRGGGMASVGLPADAVRQQIEPWAGTVEV
AAINGPAATVVSGPGDALEVLVARWQADGVQARRITVDYASHCADVSVLRRPILDALAPI
TPQRSRIPFYSTVTGDVMDGTALDADYWYRNLRRPVRFEDATRSLARDGYRLFVESGSHP
VLTVPLQETLDAAGVAGRALGTLRRDRAGLRQFTAALAEAHVSGAHIEWGRVGWARRAGH
RQWVDLPTYAFQHRRYWLDGGAPRRDAAAGMDAGDHPMLAASVELGDGRGAVFTGVLSPH
RLPWLNEHAVDGTVVLPGTAFVELALHAGHRAGCSRLAELTLETPATIPTGGELAVQVAV
LTADDAGHRTVSVHSRPADAAAQTPWTRHAVGTLTAAVHTAPVPIRPWPPADATPIDVSG
LYDALDETGYGYGPTFRGLRAAWRRGDDLYGEVRLGGEDPAATVAGYGIHPAVFDAALHL
IAFAAAAAGARDLRLPFAWDDVQLHAVGAVALRVHIAPAGPERYRVAAYDTAGHRVLTAQ
SLALRPFAGPRTPAAATGTGLYRVEWIPVDAGAAPTADLTPLGEALTGGDPAGRTLLLAG
EPGDEPDVPTRAHAAAEAALRAVQAWLADDRLAETRLLVTTRRAVTVADDEPIDVCAAPV
WGLIGAVQNEHPDRITLVDLDRPPGDLPDPGVLSAALACNEPQLAVRAGTLLAPMLAPAA
PTTDAPHGDPVPFGPDGTVVVTGGTGTIGRLVARHLVRRYGVRRLVLTGRHTVRAERAAE
LRAEFADAGAEIRAVACDVADRAAVAALLDAVPDLSGVVHAAGVLDDATAATLTPDQLHA
VLRPKVDGAWHLHELTRDRGLAAFVLFSSAAGVLGGAGQANYAAANVFLDALAQHRRAEG
LPGLSLAWGLWDRPSGMTAHLNAADLDRLQRTGIDTLTPEAGLALFDAALAANRALTVPI
RLSTPSRRPDGEALPPILRRVLGPSRRRAAAAPSAPGLADELRALDPAERHARVLDIVTT
YVAAVLGHDGKEAIDPERAFKHLGFDSLTAVQLRNQLTTATGVRLAATVVFDHPTADALA
REIAARLLGPEDDPHPAPAARRHRDDDPIAIVGMACRYPGGVSCPDELWRLVRDGRDAVG
AYPDNRGWNLDEVYDPDPERSGTTYMRAGGFLHDADRFDAAFFGISPREAVAMDPQHRLL
LESAWEALEHARIPPNSPGLTDTGVYVGMMGGDYGFHLMTRRHTDAEGYLMTGTSNSVAS
GRIAYSLGFTGPAVTVDTACSSSLVALHLAARALRDGECTLALAGGATVMATPGVLIEFS
RQRGLAPDGRCKPFSDRADGTGLSEGAGMVVLERLSDAQRHGHRVLALIRGSAVNQDGAS
NGLTAPNGPSQERVIRQALADAALDPADIDAVEAHGTGTTLGDPIEAQAVLATYGQQRDG
RPLRLGSVKSNIGHSQAAAGVAGVIKMVMAMRHGVLPPSLHSDAPTRHVDWTAGEVALLA
DPIAWPQTGRPRRAGVSSFGISGTNAHLILEQPPDVAAPPAPPRPASPLVWVLSAKSDEA
LRAQAARLTDLLDTQSPPDPADLAYSLATTRSGFTHRAAVTGETLADLRDGLTRLAEGRA
GGNAVTGTSTRGKTAFMFTGQGAQRIGMGRGLCDTYPVFARALDETCAALDEHVDTPIRQ
VLRGDADDAAAKLDRTEYTQPALFAVEVALYRLLREWGLTPDYLIGHSIGELAAAHVAGV
FSLPDAAALVAARGRLMQATAPGAMIAVRARPDDIRSRIDGRVDLAAVNGAESVVLAGAA
ADVHTVAAELSTAGIAVTPLRVERAFHSALMDPVLDEFTTVVSSTAAQPPTIPVVSTLTG
RVATAEELTSPQYWRRHLRDAVRFHDGMRTLAELGVIRCVEIGPGAGLAAHAAEVVAHPI
AALPGRGDDARGFVEAVAAASVQGLTIDWDRVLPGRRPVDLPTYAFRRRSFWPSAPARTS
GDPTELGLSPAEHPLLGAAVTLDDDTTVFTGALSRHRDSSLAAPQPDDGAPPTDAPQTLI
PAVLVELTLHAAHHVGCERIATLTLHHPLVLPAAGLLPIRVLVSPAGDDGARTVTVSSNI
GPADGPWVRNASATVDDVPAAPPDRLPGDTATEVRLDDDLDPSGFGIHPHLLQAALDPVL
GPDDWPLTWSGTRLHRTGARAVSVRFGTGEDGRHRVVAADADGAPVLTVEALHVTPRADD
GHGAGPSGARRLHRLAWTRIDDVPSAPPPGPLVVLGDADLGSSFPRCPDAAALRTARAAA
PDDGRPWTVLVGCGTDGDPGPEATHRLCARTLRLLQDWLDDAEFADSVLVVVTRNAAATG
EEADGHDVDLAAAAVWGLVGSAQNENPGRFVLLDLDRETDVDVAITSAVASGEPQVAVRD
RTMLVPRLRRMPAVERSGPLFDPRGTVLVTGGTGTLGTSVARHLVSAHGARHLVLTSRRG
PDAEGSDRLCRELRGAGAEVTVVACDTADEAALAGLLARIPAEHPLTAVIHAAGVLDDAT
LTSLTPDRLDAVLRPKVDAAWHLHRLTARVHAFVLFSSLSGVLGAPGQANYAAANRFLDA
LAQHRRAQGLPAVSIAWGMWAPPSAMTGRLGAGDLARARRSGLVAMSEADALDLFDSAVA
GDAPAVVGARLEHPDPAGPSVPAPLRGLVRQSRPRAAGSGSAVSGPNGSGPSEWAQRLTE
RPVPEQRHLVLELVRAGAAAVLGHDASDSVDPDQAFKELGFDSLAAVALRNHLGAATGLR
LPPTVVFDHPSPRAVAEFLRAELVPDPVSVAVAGIDRLRAAVAELGADDEARAAVARRLE
ALLADLEGAEGSRADTVGRIHAATGDEILDIIDRGL
NT seq 10551 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgatgcgaagctcctcgactatctgaaacgggtgaccgcagagctctatcag
gcccgggagaagcttcgcgaggtcgagggggtgagccgcgaaccgatcgccgtcgtcggg
atggggtgccggttccccggcggggtccgctccccacaggacctgtggcacctggtggaa
tccggtacggagaccgtcgccgcattccccgcggaccgcggttgggaagcggcggacctc
tacgatccgacgggccggcaggccggccggacgtacacggtgcacggcagctttctcgac
gatgcggcgggtttcgacccggaggtcttcggcatctcgcctcgcgaagcactggcgatg
gacccgcagcagcgactcctgctcgagacgagctgggagaccttcgagcacgccggcatc
gatccgcgatccgtgcacggcaggcagatcggcgtcttcaccggtctgtccgggatcgac
tactcggcacgggcgggcggcgccccgcccgaggaactcgcgggctacttcatcaccggc
accgcgatgagcgtcgcctccggtcgtgtcgcgtacagcttcggactgaacggacccgcg
atcaccgtcgacacggcgtgctcgtcgtccctggtgtccgtccacctcgccatgcaggcg
ctgcgccacggcgagtgcgaactcgccctcgccggcggggcgaccgtcatgtcgacgccc
gcggtgttcgtcgagttcagccggcagcgtggactggcccgagacgggcgctgcaaggca
ttcgccgccgcggccgacggcacggcgtggggcgaaggcgtcgcgatcctcgcgctggaa
cgcctgtccgacgcccagcgcaacgaccaccggatcctcgccgtcgtccgcggcagcgcg
gtgaaccaggacggcgccagcaacggcctgaccgccccgaacaagcaggcccaggaacgg
gtgatccggcaggccctggccgacgccggactcggcccggccgacgtcgacgcggtcgaa
gcccacggcaccggcaccacgctgggcgatcccatcgaggcgtccgccctgctggccggc
tacggccgcgatcggccccccgaccggccgttgtggctcggttcggtgaagtcgaacctc
gggcacacccaggccgccgccggagtggccggcgtgatcaaaatgatcatggcgatgcgt
cacggtgtgctgccgaagacgctgcacgtcgaccgtcccaccccccacgtcgactggacc
gccggatcggtgtccctgctcaccgagaaccgggaatggccggcgaccgaccggccccgc
cgcgcggcggtctcctcgttcggcatcagcggcacgaacgcccacgtcgtgctggaacaa
ccggccccaccgccggacgccgcgccccccgaggggaccgacggctcggacgacgtcgtg
gcctggttcgtgtcgggccacaccgaaccggcgttgcgcgcgcaggcgcaccggctgcgg
gactacgtcgccggccaccccgagctgacccccgcgcaggtggccggcccgctgctgacc
tcccgcgcgaccttccaccaccgcgccgccgtgctcggcgccgacccgcgcgccctgctg
tccggtctcgacgcgctcggccgaggcgcccccgaccccggtgtgatcaccggcgtcgcg
gtcgaggcgggcgaccggccggtgttcgtctttcccgggcagggcgcgcagtgggtcggc
atggccaccgcactgctggaatcctccccgctgttcgccgacagcctgcgcgagtgcgcc
gacgccctcgccccgcacaccgagttcgcgctgctcgacgtgctccgcgaccgcgatccg
tccgccctggaccgggccgacgtcgtgcaaccggcgctgttcgcggtgatggtcgggctt
gcgcggctgtggcaggcacacggcgtcgaaccggcggccgtggtcggacactcgcagggc
gagatcgccgccgcccacgtcgccggcgcgctgaccctgcccgacgcggcgctcgccgtc
gcggcccgcagccgcgtgatcacggaatcggcccgccgcggcggtggcatggcgtcggtg
ggtctgccggcggacgccgtgcggcagcagatcgaaccctgggccgggaccgtcgaggtg
gcggcgatcaacggtccggccgcgacggtcgtgtccggccctggcgacgcccttgaggtg
ctggtcgcgcggtggcaggccgacggtgtccaggcccggcgcatcaccgtggactacgcc
tcccactgcgcggacgtctcggtgctgcgccggcccattctcgacgctctcgccccgatc
accccgcagcgttcgcggatcccgttctactcgacggtgaccggggacgtgatggacggc
accgcactcgacgctgactactggtaccggaacctgcgccgaccggtgcgcttcgaagac
gcgacgaggtccctggcccgcgacgggtaccggctgttcgtcgagtcgggcagccatccg
gtcctgaccgtgccgctgcaggagaccctggacgcggccggcgtcgcgggtcgcgccctc
ggcaccctccgccgcgaccgggcgggcctgcgtcagttcaccgccgccctcgccgaggca
cacgtgtccggggcgcacatcgagtggggccgggtcgggtgggctcgccgcgccggtcac
cggcaatgggtggacctgcccacgtatgccttccagcatcgccgctactggctggacgga
ggcgcgccccgacgtgatgccgcagccggcatggacgccggggaccacccgatgctcgcc
gcctcggtcgagctcggcgacggtcgcggcgccgtgttcaccggcgtgctgtcgccgcac
cgactgccgtggctgaacgagcacgccgtggacggcaccgtcgtgctgcccggcacggcg
ttcgtcgaactcgccctgcacgccgggcaccgcgccggctgcagccgtctcgcggaactc
accctcgagacacccgcgacgattcccaccggtggggagctcgcggtgcaggtcgccgtc
ctcaccgccgacgacgccgggcaccgcacggtgtcggtgcactcccgtccggcggacgcc
gcggcgcagaccccgtggacccggcacgccgtcggcaccctcacggcggcggtacacacc
gcgcccgttccgatccggccgtggcccccggccgatgcgacgccgatcgacgtgagcggc
ctgtacgacgcgctcgacgagaccggatacgggtacgggccgacgttccggggcctgcgc
gcggcgtggcgccgcggtgacgacctgtacggggaggtgcgcctcgggggagaggacccc
gccgcgacggtcgccgggtacgggatccatccggcggtgttcgacgcggcactgcacctg
atcgcgttcgccgccgccgcggccggcgcccgcgacctgcggctgccgttcgcctgggac
gacgtgcagctgcacgccgtcggcgccgtcgccctgcgcgtgcacatcgccccggccgga
cccgaacggtaccgggtggccgcgtacgacaccgccggccatcgcgtgctgaccgcgcag
tcgctggcgctgcggccgttcgccggtccgcgcaccccggccgccgcgaccggcaccggc
ctctaccgcgtggagtggatcccggtcgacgccggcgccgcgccgacggcggatctcacc
ccgctcggggaggcgctcaccggcggcgatcccgccggccgcaccctgctgctggccggg
gaaccgggcgacgaacccgacgtgccgacgcgcgcgcacgccgccgcggaggcggcgttg
cgggcggtacaggcgtggctcgccgacgaccgtctcgccgagacccgactgctggtgacg
acgcggcgcgccgtgacggtcgccgacgacgaaccgatcgacgtctgcgccgcgcccgtg
tgggggctgatcggtgcggtgcagaacgaacacccggaccggatcaccctggtggacctg
gaccggccgcccggtgaccttcccgatcccggtgtgctgtccgcggccctggcctgcaac
gaaccacaactggcggtccgcgccgggacactcctcgcgcccatgctcgcgccggcggcg
cccaccaccgatgcgccgcacggggatccggtgccgttcggccccgacggcaccgtcgtc
gtcaccggcggcaccggcaccatcggccggctcgtcgcccgtcacctcgtgcggcggtac
ggggtgcgccggctcgtgctgaccggccgacacacggtccgcgccgagcgggcagcggaa
ctccgcgccgagttcgccgacgcgggcgccgagatccgcgccgtggcctgcgacgtggcc
gatcgagccgcggtggcggccttgctcgatgcggtccccgacctgtcgggtgtcgtccac
gccgccggggtgctcgacgacgccaccgccgccaccttgactccggaccagctgcacgcc
gtcctgcgccccaaggtggacggtgcctggcatctgcacgaactcacgcgcgatcgcggt
ctcgcggcgttcgtgctgttctcctccgcggcgggtgtgctcggcggcgccggccaggcg
aactacgcggcggccaacgtcttcctcgacgcgctcgcgcagcaccgccgcgccgagggg
ctaccgggactgtccctggcctgggggctgtgggaccgacccagcgggatgaccgcccat
ctgaatgcggccgatctggatcggttgcagcgcaccggcatagacaccctcaccccggag
gccgggctggccctgttcgatgcggcactcgccgcgaaccgtgcgttgacggtgccgata
cggctctccacgccctcccgcaggcccgacggcgaggcccttcccccgatcctgcgccga
gtgctcggcccgtcccgccggcgcgccgcggccgccccgtcggcccccggcctcgccgac
gagctgcgcgcgctcgaccccgccgagcggcacgcccgggtcctcgacatcgtcaccacg
tacgttgcggcggtgctcggccacgacgggaaggaggccatcgatccggagcgtgccttc
aagcacctcggcttcgactcgctcaccgcggtgcagctacgcaaccagctgacgacggcc
accggggtgcggctggccgcgacggtggtgttcgaccaccccaccgcggacgcgctcgcc
cgcgagatcgcggcccggctgctcggccccgaggacgacccgcacccggcccccgcggcg
cgccggcaccgcgacgacgacccgatcgcgatcgtgggaatggcctgccgataccccggt
ggggtctcctgcccggacgagctgtggcgcctcgtccgcgacggccgcgacgccgtgggc
gcgtaccccgacaaccgcggctggaacctcgacgaggtgtacgacccggatcccgagcgc
agcggcacgacctacatgcgggccggcggcttcctccacgacgccgaccggttcgacgcc
gcgttcttcgggatcagcccccgcgaggccgtcgcgatggacccgcaacaccgactgcta
ctcgaaagcgcctgggaagcactggaacacgcgcgaatcccgccgaactcacccggtctc
accgacaccggcgtgtacgtcggaatgatgggcggcgactacggattccacctcatgacc
cggcgacacaccgacgccgagggctacctcatgacgggcaccagcaacagcgtcgcctcc
ggccggatcgcctactcgctcggcttcaccggtcccgcggtcaccgtcgacaccgcgtgt
tcgtcgtcgttggtggcgctgcacctcgcggcacgggcactgcgcgacggcgaatgcacc
ctcgcgctggccggcggggcgacggtgatggcgacccccggcgtgctgatcgagttcagc
cgccaacgcggactcgccccggacgggcggtgcaaaccgttctccgatcgagcggacggc
accgggctcagcgagggcgcgggcatggtcgtgctcgagcggctgagcgacgcccagcgc
cacggccaccgggtgctggccctgatccgcggctccgcggtcaaccaggacggcgcctcc
aacggcctcaccgccccgaacggtccgtcgcaggaacgggtgatccggcaggcgctggcc
gacgccgccctcgaccccgccgacatcgacgcggtggaggcccacggcaccggcacgaca
ctcggcgacccgatcgaagcccaagcggtgctcgccacctacgggcagcaacgcgacggc
cggccgctgcggctggggtcggtgaagtcgaacatcggccactcccaggcggcggccggg
gtggccggcgtgatcaagatggtgatggcgatgcggcacggcgtgctgccgccgagcctg
cacagcgacgccccgacccggcacgtcgactggaccgccggcgaggtcgccctgctcgcc
gacccgatcgcgtggccgcagaccggacgaccccgccgcgccggcgtctcctcgttcggc
atcagcggcaccaacgcccacctgatcctcgagcagccccccgacgtcgccgccccaccg
gccccgccccggccggcgtcgcccctggtgtgggtgctctccgccaagtccgacgaggcg
ctgcgcgcgcaggccgcccggctgaccgacctcctcgacacgcagtccccgccggacccc
gccgacctcgcctactcgctggccaccacccggtccggcttcacgcaccgcgccgccgtc
accggcgagacgctcgccgacctgcgcgacggcctgacccgcctggccgagggacgcgca
ggcggcaacgccgtcaccgggacgagcacccgtgggaagacggcgttcatgttcaccggc
cagggcgcgcagcggatcggaatgggccgcggcctctgcgacacctacccggtgttcgcc
cgcgccctggacgagacctgcgccgcgctcgacgaacacgtcgacaccccgatccggcag
gtgctccggggcgacgcggacgacgccgccgcgaaactcgaccgcaccgagtacacccag
ccggccctgttcgccgtcgaggtcgccctctaccgactactgcgggagtggggcctcaca
cccgactacctgatcgggcattcgatcggagaactcgccgcggcccacgtcgcgggcgtg
ttcagcctgcccgacgccgccgccctggtggccgcgcgcggacgactgatgcaggccacc
gcccccggggcgatgatcgccgtccgggcacgcccggacgacatccggtcgcggatcgac
ggccgagtcgacctcgccgcggtcaacggcgccgaatccgtggtgctcgcgggggccgca
gccgacgtgcacaccgtcgccgccgaattgtccaccgcagggatcgcggtcaccccgctg
cgggtcgaacgcgcattccactcggcgctgatggaccccgtcctcgacgagttcaccacc
gtcgtgtcgagcacggcggcgcagccgccgacgatccccgtcgtctccaccctcaccggg
cgtgtcgccacggccgaggaactgacgtcaccgcagtactggcgccggcacctccgcgac
gccgtgcgtttccacgacggcatgcgcaccctcgccgaactcggcgtcatccgttgcgtc
gagatcggacccggcgcgggcctggccgcccacgccgccgaggtcgtcgcgcacccgatc
gccgcgctgcccgggcgcggggacgacgcccgggggttcgtcgaggcggtcgccgccgcg
tccgtgcagggcctgacgatcgactgggatcgggtgctgcccggccgccgcccggtggac
ctgcccacgtacgccttccggcgccgctccttctggccgtcggcgcccgcacgcaccagc
ggtgatccgacggagctggggttgagcccggcggagcatccgctgctcggcgcggccgtg
accctcgacgacgacaccaccgtgttcaccggagcgctgtcccggcaccgggattcgtcg
ctcgcggcgccgcagcccgacgacggcgctccaccgaccgacgctccgcagacgctgata
ccggccgtcctggtcgagctgaccctgcacgccgcccaccacgtcgggtgcgagcgcatc
gccactctcacgctgcaccaccccctggtcctcccggccgcggggctgctgccgatccgg
gtgctcgtgtcgcccgccggcgacgacggcgcgcgcaccgtcaccgtctcgtcgaacatc
ggaccggccgacggcccctgggtgcggaacgcgtcggcgaccgtcgacgacgtgcccgca
gcgccaccggaccggctcccgggcgacaccgcgaccgaggtgcgcctcgacgacgacctc
gacccgagcggcttcggcatccatccgcacctgctgcaggcggcgctcgaccccgtcctc
ggcccggacgactggccgctgacctggtcgggaacccggctccaccgcaccggtgcgcgg
gcggtgtcggtgcggttcgggacgggcgaggacgggcggcatcgcgtcgtcgccgccgat
gccgacggcgcgccggtgctgaccgtcgaggcgctgcacgtgacaccccgggcggacgac
gggcacggcgcgggcccgtccggcgcgcggcgactgcaccggctggcctggacccgaatc
gacgacgtcccgtccgcgccgccgcccgggccgctggtcgtgctcggcgacgcggatctg
ggctcgagcttcccgcgctgtcccgacgcggcggcgctgcgcaccgcgagggcagccgct
cccgacgacgggcggccctggacggtgctggtgggatgcggcaccgacggcgacccgggg
ccggaggcgacccaccgcctgtgcgcccggacgctgcgactgctgcaggactggctcgac
gacgccgagttcgccgacagcgtgctggtggtcgtcacccgcaacgcggcggccaccggc
gaggaggccgacgggcacgacgtcgacctcgcggctgcggccgtgtggggtctggtgggc
tccgcgcagaacgagaacccggggcggttcgtgctgctcgacctcgaccgcgagacggac
gtggacgtggcgatcacgtcggccgtggccagcggggaaccgcaggtcgcggtccgggac
cgaacgatgctcgtgccccgactgcggcgcatgccggccgtcgagcggtccggaccgctg
ttcgatccccgcggcaccgtgctcgtcaccggcggcaccggcacgctgggaacgtcggtg
gcgcgccacctcgtcagcgcacacggggcgcggcacctggtgctgacgagccggcgcgga
cccgacgccgagggaagtgaccggctgtgccgcgaactgcgcggtgcgggcgccgaggtg
accgtcgtcgcctgcgacaccgccgacgaggcggcactggcggggctgttggcccggatc
cccgccgagcaccccctgaccgcggtgatccacgcggccggtgtcctcgacgacgccacg
ctcacctcgctcactcccgaccggctcgacgcggtgctgcggccgaaagtggacgcggcc
tggcacctgcaccggctgaccgcccgggtccacgccttcgtgctgttctcgtcgctctcc
ggggtcctcggcgcgcccgggcaggcgaactacgcggcggcgaaccggttcctcgacgcc
ctcgcccagcaccggcgagcccagggcctgcccgcggtgtcgatcgcgtggggaatgtgg
gcaccgccgagcgccatgaccggcaggctcggcgcgggggatctcgcccgggcccgccgc
agcggtctggttgcgatgagcgaggccgacgccctggacctgttcgacagtgccgtcgcc
ggcgacgcccccgcggtggtgggggcccggctcgagcaccccgatccggccgggccgtcc
gttcccgccccgctgcgcggactcgtgcggcagtcgcggccccgcgcggcgggatcgggg
tcggccgtgtccggaccgaacggatccgggccgtccgagtgggcgcagcggctcaccgag
cggccggtgccggaacagcggcacctcgtgctggagctggtgcgagccggcgctgccgca
gtcctgggccacgatgcgtcggactcggtcgatcccgaccaggcgttcaaggaactcggc
ttcgactcgctcgccgcggtcgccctgcgcaaccatctcggtgccgcgaccggtctgcgg
ttgccgccgacggtggtgttcgatcatcccagtccccgggccgtcgccgagttcctgcgc
gccgagctggtcccggatccggtgtcggtggccgtcgccgggatcgaccgcctgcgggcg
gccgtcgccgaactcggcgccgacgacgaggcacgcgcggcggtcgcgcggcggctcgaa
gccctgctggccgacctcgagggagccgaggggagccgcgccgacacggtcggcaggatt
cacgccgcgaccggtgacgagatcctcgacatcatcgaccggggtctgtga

DBGET integrated database retrieval system