KEGG   Rhodococcus ruber: CS378_07235Help
Entry
CS378_07235       CDS       T05142                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00020  Citrate cycle (TCA cycle)
rrz00480  Glutathione metabolism
rrz01100  Metabolic pathways
rrz01110  Biosynthesis of secondary metabolites
rrz01120  Microbial metabolism in diverse environments
rrz01130  Biosynthesis of antibiotics
rrz01200  Carbon metabolism
rrz01210  2-Oxocarboxylic acid metabolism
rrz01230  Biosynthesis of amino acids
Module
rrz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rrz_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CS378_07235
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CS378_07235
Enzymes [BR:rrz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CS378_07235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ATQ28533
UniProt: A0A098BM35
LinkDB All DBs
Position
complement(1589002..1590219)
Genome map
AA seq 405 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWQFIKDKLIHPYLDVNLEYYDLGIEHRDATDDQVTVDA
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGTIFRAPIIISNVPRL
VPGWTKPVIVGRHAFGDQYRATDFKVDRPGTVTITFTPEDGSEPIQHEVCRIPEDGGVVM
GMYNYKKSIQDFARASLSYGLQQNYPVYLSTKNTILKAYDGMFKDEFQRIYEEEFKAEFD
AAGLTYEHRLIDDMVASSLKWEGGYVWACKNYDGDVQSDTVAQGYGSLGLMTSVLMTPDG
RTVEAEAAHGTVTRHFRQHQAGKPTSTNPIASIFAWTRGLEHRGKLDNTPEVIEFAQQLE
DVVIKTVEAGQMTKDLALLIGPEQAWLTTEEFLAALDENLQKARA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagatcaaggttgaaggaacggtcgtcgaactcgacggcgacgagatgacccgc
atcatctggcagttcatcaaagacaagctgatccatccctacctggatgtgaatctcgag
tactacgacctcggcatcgagcaccgcgatgcgaccgacgaccaggtcaccgtcgatgcg
gccaacgccatcaagaagcacggcgtcggcgtcaagtgcgcgaccatcactcccgacgag
gcccgggtcgaggagttcggcctgaagaagatgtggcgctcgcccaacggcacgatccgt
aacatcctgggcggcaccatcttccgtgccccgatcatcatctcgaacgtgccgcgcctg
gtgccgggctggaccaagccggtcatcgtcggccgtcacgccttcggcgaccagtaccgc
gccaccgacttcaaggtcgaccgcccgggcaccgtcaccatcaccttcacgccggaggac
ggctccgagccgatccagcacgaggtgtgccggattcccgaggacggcggcgtagtcatg
gggatgtacaactacaagaagtccatccaggactttgcgcgggcctcgctgtcctacggc
ctgcagcagaactacccggtctacctctcgaccaagaacacgatcctcaaggcctacgac
ggcatgttcaaggacgagttccagcggatctacgaggaggagttcaaggcggagttcgac
gccgccggactcacctacgagcaccgtctcatcgacgacatggtcgcttcctcgctcaag
tgggagggcggctacgtctgggcctgcaagaactacgacggcgacgtccagtcggacacc
gtcgcgcagggctacggttcgctgggcctgatgacctccgtgctcatgaccccggacggc
aggaccgtcgaggccgaggccgcgcacggaaccgtcacccggcacttccggcagcaccag
gccggcaagccgacgtcgacgaacccgatcgcgtcgatcttcgcctggacccgtggtctc
gagcaccgcggcaagctcgacaacacccccgaggtgatcgagttcgcccagcagctcgag
gacgtcgtcatcaagaccgtcgaggccggccagatgaccaaggacctcgccctgctcatc
gggcccgagcaggcttggctgaccaccgaggagttcctcgccgcgctcgacgagaacctc
cagaaggcccgcgcctga

DBGET integrated database retrieval system