KEGG   Rhodococcus ruber: CS378_07470Help
Entry
CS378_07470       CDS       T05142                                 

Definition
(GenBank) hypothetical protein
Organism
rrz  Rhodococcus ruber
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 FGGY_C
Motif
Other DBs
NCBI-ProteinID: ATQ28572
UniProt: A0A2D1ZVY4
LinkDB All DBs
Position
1639700..1641181
Genome map
AA seq 493 aa AA seqDB search
MGSALVVEGPGEHTTEYRFLAADPETAGDLGDLVIDALSLMSTQIDGHAVPDAVAVAYRT
SEHAEAIRSASVRDGHIVHLVPETTAVLAYLNSTGLVDTADTLAVADLGASGFTVSVVDR
RSGSMLRSARTGDVGGGAVRARVYDHVRRRIGRTRGRIPIDPALLTVRCQGALEALGEAS
TTRIELGDAGPAVPLTRTELDEMVADLSDTAATFTRRVCHTEPRPQMLALVGGAAAMPAL
ADAVTSAFAGPVAVVPEPATAAAHGAALLAASSRLSSYPSVGASTPTAGTPGGKVSGALA
GALVIGALVAGYATDQIASDDTAVSPAGTSGQATTQPAAAVPDTGHTQIPSEDPHAAVTT
TAADNGYARTDTPVPYPTPTVPESSTTTPATTTPPSTPESTTSERPESPADVPGTDRPWQ
LPGTLPSVPLPTVPLPTLPGTTPSESTTPSSTTSAPPSEFAPPETTTETSSTAAPAEEAT
STSPPLIEPSPAA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
gtgggctcggccctcgtcgtcgaggggccgggagagcacaccaccgagtaccgatttctc
gccgccgatcccgagaccgccggcgacctgggcgacctcgtcatcgatgccctctccctc
atgagcacccagatcgacggacacgccgtccccgacgcggtggcggtggcctatcgaacc
tccgagcacgcggaggcgatccgctccgcgtcggtgcgcgacggccacatcgtccatctg
gttccggagacgacggccgtgctcgcctacctgaacagcaccgggctcgtcgacaccgcc
gacaccctcgccgtcgccgacctgggggcgtcgggattcaccgtctccgtcgtcgaccga
cggtccgggtcgatgctgcgctcggcccggaccggggacgtcgggggcggagccgtccgt
gcccgcgtctacgaccacgtgcgccgccggatcggccgtacccgtggccgcatcccgatc
gaccccgccctgctgacggtgcgctgtcagggcgcactcgaggccctcggagaggcgtcc
acgacccggatcgaactcggtgacgccggaccggcggtgcccctgacccgcacggaactc
gacgagatggtggccgatctcagcgacaccgcggcgacgttcacccggcgggtctgccac
accgaaccgcggccgcagatgctggcgctcgtgggcggcgcagcggcgatgccggctctg
gccgacgccgtgacctcggccttcgccggccccgtcgcggtggtgccggaaccggccacc
gccgcggcccacggcgccgcgctgctcgccgcgtcgtcacgactgtcctcctatccgtcg
gtaggtgcctcgaccccgacggcgggcacccccggcggcaaggtctccggtgccctcgcc
ggggcgctcgtgatcggtgcgctcgtcgcgggctatgcgaccgaccagatcgcgtccgac
gacaccgccgtgtcccccgccgggaccagcggccaggccacgacccagccggcggcggcc
gtccccgacaccggacacacgcagatcccctccgaggatccccacgccgccgtcaccacg
acagctgccgacaacggctacgcacgcacggacacgccggtgccctatcccactcccacc
gtgcccgagtcgtcgacgaccacgccggcgacgaccacgccgcccagcacaccggaatcg
acgacgagcgagcggcccgagtcgcctgcggacgtccccggcaccgaccggccgtggcag
ttgccgggaaccctcccgagcgttccgctgccgaccgtcccgctgccgacgctgcccggc
acgacgccgtccgagagcacgacaccgagctcgacgacgtccgcgccgccgtccgagttc
gcaccacccgagacgacgaccgagacctcctcgaccgcggccccggcggaggaggcgacg
agcacgtcaccgcctctcatcgaaccgtcaccggccgcctga

DBGET integrated database retrieval system