KEGG   Rhodococcus ruber: CS378_10260Help
Entry
CS378_10260       CDS       T05142                                 

Definition
(GenBank) pyridoxal phosphate-dependent aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00220  Arginine biosynthesis
rrz00250  Alanine, aspartate and glutamate metabolism
rrz00290  Valine, leucine and isoleucine biosynthesis
rrz01100  Metabolic pathways
rrz01110  Biosynthesis of secondary metabolites
rrz01130  Biosynthesis of antibiotics
rrz01210  2-Oxocarboxylic acid metabolism
rrz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rrz00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CS378_10260
   00290 Valine, leucine and isoleucine biosynthesis
    CS378_10260
   00220 Arginine biosynthesis
    CS378_10260
Enzymes [BR:rrz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     CS378_10260
    2.6.1.66  valine---pyruvate transaminase
     CS378_10260
Amino acid related enzymes [BR:rrz01007]
 Aminotransferase (transaminase)
  Class I
   CS378_10260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP BRE Aminotran_MocR Alliinase_C
Motif
Other DBs
NCBI-ProteinID: ATQ29083
LinkDB All DBs
Position
2288225..2289490
Genome map
AA seq 421 aa AA seqDB search
MDAVSTGEQGHLHHRISRKLEQSAKLQNVLYEIRGPVHAHAARLEAEGHRILKLNIGNPA
PFGFEAPETIVQDMIAALPHAQGYSESKGIASARRAIVTRYELVPGFPKLDINDVYLGNG
VSELITMTMQALLDDGDEVLIPAPDYPLWTAMTSLAGGTPVHYLCDESNEWNPDIEDIES
KITDKTKALLVINPNNPTGAVYSLEVLEQLVQLARRHQLLLLADEIYDKILYDDAKHISL
ATLAPDLLCLTYNGLSKAYRVAGYRSGWMTITGPKEHAAGFLEGIDLLASTRLCPNVPAQ
HAIQVALGGHQSIEDLILPGGRLLEQRDVAWERLNSIPGVSCVRPRGALYAFPRLDPEVY
EIHDDEKLVQDLLLQEKILMVQGTGFNWPDPDHLRIVTLPWARDLAVAIERFGNFLSSYK
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggacgccgtgagtacaggagaacagggccaccttcaccaccgcatcagccggaaactc
gagcagtccgcgaagctgcagaacgtgctgtacgagatccgcgggccggtgcacgcgcac
gccgcgcggctcgaggcggaggggcaccgcatcctcaagctcaacatcggcaacccggcg
ccgttcgggttcgaggcgccggagacgatcgtgcaggacatgatcgccgcgctgccccac
gcccagggttactcggagtcgaagggcatcgcgtcggcgcgccgggccatcgtcacccgc
tacgaactcgtgccgggcttcccgaagctcgacatcaacgacgtctacctcggcaacggc
gtctccgagctgatcacgatgacgatgcaggccctgctcgacgacggcgacgaggtgctg
atcccggcgccggactacccgctgtggacggcgatgacgtccctggccgggggcacgccg
gtgcactacctgtgcgacgagtccaacgagtggaatcccgacatcgaggacatcgagtcg
aagatcacggacaagaccaaggccctgctggtcatcaacccgaacaacccgacgggcgcc
gtgtactcgctcgaggtgctcgaacagctggtgcagctggcccgccggcaccagctgctg
ctcctggccgacgagatctacgacaagatcctctacgacgacgccaagcacatctccctg
gccaccctcgcccccgacctgctgtgcctgacctacaacggcctgtcgaaggcctaccgg
gtggccggataccggtcggggtggatgacgatcaccggtccgaaggagcatgcggccggc
ttcctcgagggcatcgatctgctcgcctcgacccgcctgtgccccaacgtgccggctcag
cacgccatccaggtcgcgctcggcgggcaccagagcatcgaggacctgatcctgcccggt
ggccggctgctcgagcagcgcgacgtcgcgtgggagcgcctgaactcgattcccggggtg
agctgtgtcaggccccgcggcgccctgtacgccttcccgcgcctcgatccggaggtgtac
gagatccacgacgacgagaagctggtccaggacctgttgctgcaggagaagatcctgatg
gtgcagggcaccggtttcaactggccggatccggaccatctgcggatcgtgacgctgccc
tgggcccgcgacctcgcggtggccatcgaacggttcggcaacttcctgtccagctacaag
cagtga

DBGET integrated database retrieval system