KEGG   Rhodococcus ruber: CS378_11255Help
Entry
CS378_11255       CDS       T05142                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
rrz  Rhodococcus ruber
Pathway
rrz00250  Alanine, aspartate and glutamate metabolism
rrz00280  Valine, leucine and isoleucine degradation
rrz00310  Lysine degradation
rrz00410  beta-Alanine metabolism
rrz00640  Propanoate metabolism
rrz00650  Butanoate metabolism
rrz01100  Metabolic pathways
rrz01120  Microbial metabolism in diverse environments
Module
rrz_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CS378_11255 (gabT)
   00650 Butanoate metabolism
    CS378_11255 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CS378_11255 (gabT)
   00280 Valine, leucine and isoleucine degradation
    CS378_11255 (gabT)
   00310 Lysine degradation
    CS378_11255 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CS378_11255 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rrz01007]
    CS378_11255 (gabT)
Enzymes [BR:rrz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CS378_11255 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CS378_11255 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     CS378_11255 (gabT)
Amino acid related enzymes [BR:rrz01007]
 Aminotransferase (transaminase)
  Class III
   CS378_11255 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ATQ29259
LinkDB All DBs
Position
2528355..2529743
Genome map
AA seq 462 aa AA seqDB search
MTSIEYRLPQQRRLVTALPGPRSAALTERRRTAVGAGVASSVPVYAADVDGGIVVDVDGN
ALIDLGSGIAVTSVGASDPAVVAAVQEQVAHFTHTCFMVTPYEGYIAVAEKLAALTPGDH
AKRTVLFNSGAEAVENAVKIARVATGRSAVVVFDHAYHGRTNLTMALTAKNQPYKEGFGP
FAPDIHRVPASYPFREGRNYDGTEVTGEQAAHRAISQIDKQIGAHNVAAIVLEPIQGEGG
FIVPAKGFLPTLVDWAKANGIVFVADEVQTGFARTGDWFASNDENVVPDLMTLAKGIAGG
MPLAAVTGRAELIDAVHGGGLGGTYGGNPVACAAALATLDRIEQLDLRGRARRIEQIATE
QLRALAADVDIVGEVRGRGAMLAVEFVQPGTREPNPEATKAIAAKALEQGVIVLTCGTYG
NVVRLLPPLVISDELLTDGLDVLTAAVRDVAGVRPTLAGATR
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcatcgaataccgccttccacagcagcgtcgcctggtcaccgcgctgcccggc
ccgcgctcggcggccctgaccgagcgtcgccgtaccgcggtcggggcgggtgtggcgtcc
tccgtgccggtctacgccgccgacgtcgacggcgggatcgtcgtcgacgtcgacggcaac
gccctgatcgacctgggttccggtatcgcggtcaccagcgtcggcgcctcggacccggcg
gtcgtggcggcggtgcaggagcaggtcgcgcacttcacgcacacctgcttcatggtcacc
ccctacgagggctacatcgccgtcgccgagaagctcgcggccctgacccccggcgaccac
gccaagcgcacggtgctgttcaacagcggcgccgaggccgtcgagaacgcggtgaagatc
gcccgcgtcgccaccggccgcagcgccgtggtggtcttcgaccacgcctaccacggccgc
accaacctgacgatggcgctcaccgcgaagaaccagccctacaaggagggcttcggcccg
ttcgccccggacatccaccgcgtgccggcgtcctacccgttccgggaaggccgcaactac
gacggcaccgaggtcaccggcgagcaggccgcccaccgcgcgatctcgcagatcgacaag
cagatcggcgcgcacaacgtcgccgcgatcgtgctcgagcccatccagggcgagggcgga
ttcatcgtgccggccaagggattcctgccgaccctcgtcgactgggcgaaggccaacggc
atcgtcttcgtcgccgacgaggtgcagaccggcttcgcacgcacgggtgactggttcgcc
agcaacgacgagaacgtcgtcccggacctgatgaccctcgccaagggcatcgccggcggc
atgccgctcgccgcggtgaccggccgcgccgagctgatcgacgccgtgcacggcggcgga
ctcggcggcacctacggcggcaaccccgtcgcgtgtgccgcggcgctcgccaccctggac
cggatcgagcagctggacctgcgcggccgcgcccgtcgcatcgagcagatcgcgaccgag
cagttgcgggcgctcgccgcggacgtcgacatcgtcggcgaggtccgcggccgcggcgcg
atgctcgccgtcgagttcgtgcagcccggcacccgcgagccgaacccggaggccaccaag
gcgatcgccgcgaaggcgctcgaacagggcgtcatcgtgctcacctgcggcacctacggc
aacgtcgtccgcctgctgccgccgctggtgatctccgacgaactgctcaccgacggcctc
gacgtcctcactgccgccgtccgcgacgtcgcgggcgtgcgcccgaccctggcaggagcc
acccgatga

DBGET integrated database retrieval system