KEGG   Rhodococcus ruber: CS378_12355Help
Entry
CS378_12355       CDS       T05142                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
rrz  Rhodococcus ruber
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ATQ29436
UniProt: A0A098BU31
LinkDB All DBs
Position
2759208..2760656
Genome map
AA seq 482 aa AA seqDB search
MTDYDKLFIGGRWAAPSTDERLEVFSPATEERVGSVPVAGPQDIDAAVAAARRAFDDGPW
PRTSPSERAQVLAKAAKLIEERSADLAASLSAEMGQPPASVQMMQVTPSLATINYYAGLA
DSFPWTEERTGAFGRSRVTREPVGVVAAVIAWNVPLFLMINKLGPALLAGCTVVLKPAPE
SPLTTNAVAEIFAEAGLPEGVLSLVPGGAETGEYLVAHPDIDKITFTGSTAVGKHIGEIA
ARNLTRCSLELGGKSAAIVLEDADLDSTIAMLVMSGLMNTGQACVGQTRILAPRSRYDEV
VEKMVATAAFFPVGMPDDAAAQLGPLISAKQRDRVEGYIATGKEEGARLVLGGGRPAGLD
KGYFVEPTIFADVDNSMTIAREEIFGPVLCVIPYDSVDEAIKIANDSDYGLAGSVYTTDV
DKGLEVASRVRTGTYGINWYAFDPGSPFGGYKNSGIGRENGPEGVEAFCETKSVLYPPGY
GA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattacgacaagctcttcatcggcggacgctgggccgccccatccaccgacgag
cgcctcgaggtgttctcgccggccaccgaggaacgcgtcggttccgtgccggtcgccggg
ccgcaggacatcgacgccgccgtcgccgccgcccgtcgcgccttcgacgacggaccgtgg
ccccgcacctcgccgtccgagcgcgcccaggtgctcgccaaggccgccaagctgatcgag
gaacgcagcgccgaccttgcggcgtcgctgtccgccgagatgggccagccgccggcctcg
gtgcagatgatgcaggtgacgccgtcgctggcgacgatcaactattatgcgggccttgcc
gattcgtttccgtggacggaggagcgcaccggcgccttcggacgctcccgggtgacgcgt
gaacccgtgggcgtggtcgccgccgtcatcgcgtggaacgtgccgctgttcctgatgatc
aacaagctcggcccggccctgctcgccggctgcaccgtcgtgctcaagcccgcgcccgag
tcgccactgaccaccaacgcggtcgccgagatcttcgccgaggcgggcctgcccgaaggc
gtgctctccctcgtcccgggcggcgccgagaccggtgagtacctcgtcgcgcatccggac
atcgacaagatcaccttcaccggctcgaccgccgtcggcaagcacatcggcgagatcgca
gcacgcaacctcacccgctgctcactcgagctcggcggcaagtccgccgccatcgtcctc
gaggacgccgacctcgactcgacgatcgcgatgctcgtgatgtccggcctgatgaacacc
gggcaggcctgcgtcggccagacccgcatcctcgcgccgcgctcgcgctacgacgaggtc
gtcgagaagatggtggcgaccgccgcgttcttccccgtcggcatgcccgacgacgcggcg
gcgcaactcggaccgctgatctccgcgaagcagcgcgaccgcgtcgagggctacatcgcc
acgggcaaggaggaaggcgcgcgactggtgctcggcggcggccggcccgcaggcctggac
aaggggtacttcgtcgaaccgacgatcttcgcggacgtcgacaactccatgaccatcgcg
cgcgaggagatcttcggccccgtgctgtgcgtgatcccctacgacagcgtggacgaggcg
atcaagatcgccaacgactccgactacggcctcgccggctccgtctacaccaccgacgtc
gacaagggcctcgaggtggcgtcgcgggtgcgcaccggcacctacggcatcaactggtac
gccttcgatccgggctcaccgttcggcggctacaagaattccggcatcggacgggagaac
ggccccgagggcgtcgaggcgttctgcgagaccaagtcggtgctgtacccgcccggctac
ggcgcctga

DBGET integrated database retrieval system