KEGG   Rhodococcus ruber: CS378_12990Help
Entry
CS378_12990       CDS       T05142                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
rrz  Rhodococcus ruber
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ATQ29553
UniProt: A0A2D1ZYR3
LinkDB All DBs
Position
complement(2896572..2897639)
Genome map
AA seq 355 aa AA seqDB search
MQLPVEPPIAPMLAKAVPEVPAQPADGDPEWSYEPKWDGFRAVVFRDGDEVVLSSRGGKD
LVRYFPELTAAVRAELPARCVVDGEIVVPRPHDGRSRLDWQALSERIHPAASRIALLAEQ
TPAQFVGFDLLALGDENLMETPFARRRERLRAAVGGGPSCHVTAATLDAQIAGRWFAEFE
GAGLDGVVAKRLDGPYVPDKREMRKVKHARTADCVLIGYRPHKSIDGVGSLLLGLYDGGD
EPVMVGGASAFTVEQRQELLADLAPLRVGADVVAEGEPSRWRTAADRRWIPLRPERVLEV
AYDQMEGNAEAGLRFRHAARFLRWRPDRDPRSCTFEQLDVPVRYDLADVLDRTGV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgcagctgccagtcgaaccgccgatcgcaccgatgctcgccaaggccgtgcccgaggtt
ccggcccagcctgccgacggcgaccccgagtggtcgtacgagccgaagtgggacggcttc
cgggctgtcgtgttccgtgacggcgacgaggtggtgctgagctcgcggggcgggaaggac
ctggtgcgctacttcccggaactgaccgccgcggtgcgggcggagctgcccgcccggtgc
gtggtcgacggggagatcgtggtgccgcgcccgcacgacggccgcagccggctcgactgg
caggccctgtcggagcgtatccacccggcggcgagccgcatcgcgctgctcgccgaacag
acccccgcgcagttcgtcggcttcgatctgctcgccctcggcgacgagaacctgatggag
acgccgttcgcgcggcgccgggagcggctgcgggcggcggtcgggggcggcccgagctgc
catgtcaccgccgcgaccctcgacgcgcagatcgccggccgatggttcgccgagttcgag
ggcgccggcctcgacggggtcgtcgccaagcgtctcgacggaccctacgtgccggacaag
cgggagatgcgcaaggtcaagcatgcccgcaccgccgactgtgtgctcatcggctaccgc
ccgcacaagagcatcgacggggtcgggtccctgctgctggggctgtacgacggcggggac
gaaccggtgatggtcgggggcgcgtcggcgttcaccgtcgagcagcgccaggagttgctc
gccgacctcgcgccgctgcgggtcggtgccgacgtcgtcgccgagggcgagccgagccgg
tggcggacggccgcggaccgccgttggataccgctgcggcccgagcgggtcctggaggtg
gcctacgaccagatggagggcaacgcggaggccggcctgcggttccggcacgcggcccgg
ttcctgcggtggcggcccgaccgcgatccgcgcagctgcaccttcgagcagttggacgtg
ccggtgcggtacgacctcgccgacgtcctcgaccggacaggagtgtga

DBGET integrated database retrieval system