KEGG   Rhodococcus ruber: CS378_14175Help
Entry
CS378_14175       CDS       T05142                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
rrz  Rhodococcus ruber
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ATQ29761
UniProt: A0A098BIA1
LinkDB All DBs
Position
complement(3134623..3136077)
Genome map
AA seq 484 aa AA seqDB search
MTTATPIQLKSYDKLFIGGSWVEPSSDAVIEVISPINGEVIATVPEAREADMDRAVAAAR
KAFDEGPWPRMTPAERAEILVRVGNEVKKRIPEMAEAFTLELGAPAAVSTLFHQNAVDMW
DDAATFHERFAFEEERTWKGGHGKIVREPIGVVAVVVPWNGPVATGSLKISPALAAGCTV
VLKPAPEGPVTMMMLAEALDAAGLPEGVISVVPAGREVGDYLVSHPDVDKISFTGSTAAG
RVVMSRAAERIKRVTLELGGKSAAIIADDIDLDTFLPGMVFGGIGHSGQVCAALTRIIVP
RERQEEVVEAIKAVMESVKVGDPRDEDTVLGPLAAERQQTRVLDYIEVGKKEGARLVTGG
GKPAHLDRGWYVEPTLFADVSNDMRIAQEEIFGPVLVVIPFDSIDEAVAIANDSDYGLSG
SVYAKDEELAQSIARRVRTGQISVNGYAMCVVQPFGGYKQSGLGREGGIEGFDAFFETKL
IQLP
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagccactcccatccagttgaagagctacgacaagctgttcatcggcggatcg
tgggtcgagccgtccagcgacgcggtgatcgaggtgatctccccgatcaacggtgaggtc
atcgcgaccgtgcccgaagcgcgcgaggccgacatggaccgcgccgtcgcggcggcgcgc
aaggcgttcgacgaaggcccctggccgcggatgacgcccgccgagcgcgcggagatcctc
gtgcgcgtcgggaacgaggtgaagaagcggatcccggagatggccgaggccttcaccctc
gaattgggcgctcccgcagcggtgtccacgctgttccaccagaacgccgtcgacatgtgg
gacgacgcggccacgttccacgagcgtttcgcgttcgaggaggagcgcacctggaagggc
gggcacggcaagatcgtgcgggagcccatcggcgtcgtcgcggtcgtggtcccgtggaac
ggtcccgtcgcgaccggctcgctgaagatctcgcctgcgctcgccgcgggctgcacggtg
gtgctcaagccggccccggagggacccgtcaccatgatgatgctggccgaggcgctcgac
gccgcgggcctgcccgagggcgtcatcagcgtcgtcccggcaggacgggaggtgggtgac
tacctcgtcagccacccggacgtcgacaagatcagtttcaccggcagcacggcggccggt
cgtgtggtcatgagccgggccgcagagcggatcaagcgggtcaccctcgaactcggcggc
aagtcggccgcgatcatcgccgacgacatcgacctcgataccttcctgcccggcatggtg
ttcggcggcatcggtcattcggggcaggtctgcgccgccctcacccgcatcatcgtcccg
cgtgagcgccaggaggaggtcgtcgaggcgatcaaggcggtgatggagagcgtgaaggtc
ggtgacccgcgggacgaggacacggtcctcggacccctcgccgccgaacgtcagcagacg
cgggtgctcgactacatcgaggtcgggaagaaggaaggcgcccggctggtgaccggcggc
ggcaagccggcccacctcgaccgcggctggtacgtcgaaccgaccctgttcgcggacgtc
tccaacgacatgcgcatcgcgcaggaggagatcttcggaccggtgctggtggtgatcccg
ttcgattcgatcgacgaggccgtcgccatcgccaacgactcggactacggcctgtccggc
tccgtctacgcgaaggacgaggagctggcccagagcatcgcgcgacgggtgcgcaccggg
cagatctccgtcaacggctacgcgatgtgcgtcgtgcagcccttcggcggctacaagcag
tccggtctcggccgtgagggcggcatcgaagggttcgatgcgttcttcgagaccaagctg
atccagcttccctga

DBGET integrated database retrieval system