KEGG   Rhodococcus ruber: CS378_16250Help
Entry
CS378_16250       CDS       T05142                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rrz  Rhodococcus ruber
Brite
KEGG Orthology (KO) [BR:rrz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rrz01001]
    CS378_16250
Enzymes [BR:rrz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CS378_16250
Protein kinases [BR:rrz01001]
 Serine/threonine kinases: Other
  Bacterial family
   CS378_16250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal RIO1
Motif
Other DBs
NCBI-ProteinID: ATQ30143
LinkDB All DBs
Position
complement(3584982..3586907)
Genome map
AA seq 641 aa AA seqDB search
MTTPRKLSSRYELGEILGFGGMSEVHLARDLRLDRDVAIKVLRADLARDPTFYLRFRREA
QNAAALNHPAIVAVYDTGEAETESGPLPYIVMEFVEGDTLRDIVRSQGPMTPKRAMEVVA
DVCAALDFSHRNMIVHRDVKPANVMITRSGAVKVMDFGIARAISDAASPMTQTAAVIGTA
QYLSPEQARGEQVDARSDVYSVGCVLFEILTGKPPFQGDSPVAVAYQHVREDPPLPSSVN
SAVPPELDSVILKAMAKNPANRYQSAAEMRSDLIRVLSGQKPSAPMVMTDEDRTTILGAV
DGAGTPRNGAGNGAARGPAGAAAGGTVATPQRSRVLRNTLLGLAAVVIVGIVGVFLWTSG
PGSSAAQIPVPDVRNLAAEIAESRLQDAGFEVSVQMKPDAVVASGNVVNTRPVAGVQAEE
GSTVTLEVSSGPEQVQIPRLAGMNQQEALQALTDAGLRLDPNVARAPSSSAERDTVVDQS
PAPGADADRDSAVRVTLGSGPEQIRVPNVVGQATEVARDNIEAAGFTVVVDEIDSSQPAG
TVVSSSPAGGTSATEGDTVTIQVSNGNRIEMPALTNRTVSEALAELRAAGWTGSPAQLVQ
NREATLDPELVGKVIAQQQPPGSEISKSETLTVGVGVLGIR
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaccccgcaagctctcttcccgctacgaattgggtgagatcctcggcttcggt
ggcatgtcggaggtacacctggcccgggatctgcggctcgaccgcgacgtggcgatcaag
gtgctgcgcgccgatctcgcccgcgaccccacgttctatctccggttccgccgcgaagcc
cagaacgccgcggcgttgaaccatccggcgatcgtcgccgtgtacgacaccggtgaggcg
gagaccgagtccggcccgctgccgtacatcgtcatggagttcgtcgagggcgacacgctg
cgcgacatcgtgcgctcccaggggccgatgaccccgaagcgggccatggaggtcgtggcg
gacgtgtgcgccgccctcgacttcagccaccgcaacatgatcgtccaccgcgacgtcaaa
cccgccaacgtcatgatcacccgttccggcgcggtgaaggtgatggacttcggcatcgcc
cgggccatctccgacgccgcgagcccgatgacgcagaccgccgcggtgatcggcaccgcc
cagtacctgtcgccggaacaggcccgcggcgagcaggtggacgcccgttccgacgtgtac
tcggtcggctgcgtcctgttcgagatcctcaccggcaagccgccgttccagggtgattcc
cccgtggccgtcgcgtaccagcacgtccgcgaggacccgccgctgccgtcgtcggtgaac
tccgccgtcccgccggagctggactcggtgatcctcaaggcgatggcgaagaaccccgcc
aaccggtaccagagtgccgccgagatgcgcagcgacctgatccgcgtgctgagcggccag
aagcccagcgcaccgatggtgatgaccgacgaggaccgcaccaccatcctcggggccgtc
gacggtgccgggacaccccgcaacggcgcgggcaacggcgcggcccgcggtcccgccgga
gccgctgccggcgggaccgtggcgacgcctcagcgctcccgggtcctgcgcaacaccctg
ctgggcctggcggcggtcgtgatcgtcggcatcgtcggggtgttcctgtggacgtcgggc
ccgggatcgagcgccgcgcagatccccgtccccgacgtgcgcaaccttgccgcggagatc
gcggagagcaggctgcaggatgccgggttcgaggtctcggtgcagatgaaacccgacgcc
gtggtcgcctccgggaacgtcgtcaacacccggccggtcgccggagtccaggccgaggag
ggcagcaccgtcaccctcgaggtctcgagcggccccgaacaggtgcagatcccgcggctg
gcgggcatgaaccagcaggaggcgctgcaggccctgaccgacgccggactgcgcctcgat
ccgaacgtggcccgcgcaccgtcgtcgtcggccgaacgcgacaccgtcgtcgaccagagc
cccgctccgggagccgacgccgaccgcgacagcgcggtgcgggtgacgctcggcagcgga
cccgagcagatccgcgtgcccaacgtcgtgggtcaggccaccgaggtggcgcgcgacaac
atcgaggccgccggtttcaccgtcgtggtcgacgagatcgactcgagccagccggccggg
acggtggtgtcgagcagcccggcgggcggcaccagcgcgacggagggcgacacggtcacc
atccaggtgtccaacggcaaccgcatcgagatgcccgcgttgacgaacaggacggtgtcc
gaggcactggcggaactgcgggcggccggctggacgggctcgccggcccagctcgtgcag
aaccgcgaggccaccctcgacccggagctggtgggtaaggtcatcgcccagcagcagccg
ccggggtcggagatctccaagtcggagaccctcaccgtgggtgtgggcgtgctgggtatc
cgctga

DBGET integrated database retrieval system