KEGG   Renibacterium salmoninarum: RSal33209_2078Help
Entry
RSal33209_2078    CDS       T00641                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
rsa  Renibacterium salmoninarum
Pathway
rsa00250  Alanine, aspartate and glutamate metabolism
rsa00410  beta-Alanine metabolism
rsa00430  Taurine and hypotaurine metabolism
rsa00650  Butanoate metabolism
rsa01100  Metabolic pathways
rsa01110  Biosynthesis of secondary metabolites
rsa01120  Microbial metabolism in diverse environments
rsa02024  Quorum sensing
Module
rsa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    RSal33209_2078
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RSal33209_2078
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RSal33209_2078
   00430 Taurine and hypotaurine metabolism
    RSal33209_2078
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RSal33209_2078
Enzymes [BR:rsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     RSal33209_2078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ABY23810
UniProt: A9WSM2
LinkDB All DBs
Position
1840104..1841504
Genome map
AA seq 466 aa AA seqDB search
MRSTGSRPDRDDQQPIDLNPLFTRPGERTEFPKFTLRKEGSLPETAYQIVHDDAMLDGNA
RQNLATFVGTWMDEHANQLYLESADKNMIDKDEYPHTAAIETRCWRILATLWNAPNAEKA
IGTSTIGSSEACMLGGLALKRRWQHARRAAGLATDKPNLVLSSAVQVCWEKFCNYWDVEP
RYVPISEEHRVLDGHDLDKYVDENTIGVVAILGVTYTGMYEPVQQIAAALDQIQANTGLD
VRIHVDGASGAMIAPFLQPDLEWDFHVPRVSSINISGHKYGLVYPGVGWIVWRDASLLPE
DLVFRVSYLGGDMPTFALNFSRPGAQVLLQYYQFLRLGFDGFEAVQNACREVALYLSGEI
AGMEPFELWNDGSDIPVFAWRLKPDPERHWDLHQLSDRLRMSGWQVPSYPMPADLENITV
QRIVVRSGFSKNLAADFLGDFREQVAYLESLPAPVSTNRESTGFRH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcaccggatcaaggcccgaccgggacgaccagcaaccgatcgatttgaacccc
ctttttactcgaccgggtgaacgcaccgaatttcccaagttcacgcttcggaaagaaggt
tccctcccggagaccgcctatcaaatagtccatgatgacgcgatgttagatggcaatgcg
cggcaaaacctggccacatttgttggcacctggatggacgagcacgctaaccagctctac
cttgaatctgccgacaaaaacatgatcgacaaggatgaatatccgcataccgcagcgatt
gaaacccgctgttggcgaatattagcgacgttatggaatgcacccaatgcggaaaaggca
atcggcacctccaccattggctcctccgaagcctgcatgcttggcggattggcactaaaa
cgccgctggcaacacgcgcggcgcgccgcaggacttgcaaccgacaaaccgaacctggtg
cttagctcggcggtgcaagtctgttgggaaaagttttgcaactactgggatgtcgagccg
agatacgtaccaatctctgaagagcaccgagtcctcgacggccatgatcttgacaaatac
gttgacgaaaataccattggcgttgtagccatcctgggcgtgacttacaccggaatgtac
gagccagttcagcagatcgccgcggctctggaccagattcaagccaatactggactggat
gtgcgcatccatgttgatggcgcgtccggcgcgatgatcgcgccttttttgcaacccgat
cttgaatgggacttccatgtaccgcgtgtttcctcgattaatatttccggccacaaatat
ggcttggtgtaccccggcgtaggttggatcgtctggcgcgatgccagcctgctaccagag
gacctggttttccgagtcagctatctcggtggtgatatgccaacgttcgcactgaatttc
tcccggccgggagcccaagtgttactgcagtactaccaattcctgcgcttaggttttgac
ggcttcgaagctgtccagaacgcttgccgcgaagtggcgctctacctttccggcgaaatt
gccggcatggagcccttcgagctgtggaacgacggctctgatattccggtctttgcctgg
cggctcaaaccagatccagaacgtcactgggacttacatcagctctcagatcgattgcga
atgagcggctggcaagtgccgtcctatccgatgccagcagaccttgaaaatattacggtg
caacgcatagtggtccgcagcggtttcagcaagaatctggccgctgatttcctgggcgat
ttccgcgaacaggtcgcctatctggagtcactaccggccccggtttcaacaaaccgcgaa
tccaccggtttccggcactaa

DBGET integrated database retrieval system