KEGG   Renibacterium salmoninarum: RSal33209_2512Help
Entry
RSal33209_2512    CDS       T00641                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rsa  Renibacterium salmoninarum
Brite
KEGG Orthology (KO) [BR:rsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rsa01001]
    RSal33209_2512
Enzymes [BR:rsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     RSal33209_2512
Protein kinases [BR:rsa01001]
 Serine/threonine kinases: Other
  Bacterial family
   RSal33209_2512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Kdo DUF4599 Kinase-like RIO1
Motif
Other DBs
NCBI-ProteinID: ABY24238
UniProt: A9WRF6
LinkDB All DBs
Position
2243727..2245814
Genome map
AA seq 695 aa AA seqDB search
MQDKVQEPLVGTLVDQRYQVLSKVARGGMATVYLATDLRLDREVALKVLHPRLSMDDSFL
DRLGREAKAAARLSHPHVVGVLDQGEELRDGHQLAYLVMEYIPGHTLRDVLNDHGALSPR
LALAYLDAVVEGLAAAHRAGLVHRDVKPENVLIADDGRIKVGDFGLARAVTTSTSTGTLI
GTVAYLSPELVMGKPSDARSDIYAAGIMLFELLTGEQPFRGEVPIQVAYQHVNSVVPPPS
SVLPGLAPDLDELVRWCTESDPEDRPHDANALLGELRHIRTSLTDAQLDFSGDPNRTAAV
PAPPSFPPSSAGLTEALSSAAQPTEIFTGPPAPQATTIMDRQVNPTTMMERPAPLTVDTE
DAPRISARAAKSAQKKSDKAAAREAARNASTPVTTLRKGNSRRKGMIWLVLVLILILLGA
TAGWFFGLGPGALATVPDLKDKTVAEAQAELSKLGFNSTTQAIDDETIVQDHVVSSQPAA
QSQQRKFLSVVLLVSHGPTLYAVPAMVGGSLDAAKSALNSAHMALGAVTQQYEEQIPAGQ
VLSQDPAANVQKRAATPINLLVSQGPKPLPVPAVVGQTQEAAVKALTDAGLTPVVATDQV
NDAKVSAGSIVSQDPATGTLSKGGKVNLVVSKGPKMVNVPSFIGKQVDQAVEELKRLNLP
YKINEILGGFFGTVRAQDPVNVSVPEGTTINLTVV
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagataaggttcaagagccgttggttggcacactcgtcgaccagcggtatcaagtg
ttgagcaaggtagcgcgtggcgggatggccacggtgtaccttgccactgacctgcgcctg
gaccgagaagtggcgctcaaagtgctgcatccgcgtctgagcatggacgattcgttcctc
gaccgattggggcgcgaagcgaaggctgctgcccggttgtcgcacccgcacgtggttggc
gtactggaccaaggtgaagagctacgcgacggtcaccagctggcctatctggtgatggaa
tacattccgggccacactttgcgtgatgttctcaacgaccacggtgccttgtcgccgcga
cttgccttggcctatctcgacgccgtggttgaaggattagccgcagcacaccgtgcaggc
ttagtgcaccgtgacgtcaagcccgaaaatgtactgattgccgacgacggtcgaatcaag
gtgggcgactttggcttagcccgagcggttaccacctcgaccagtaccggaaccctgatc
ggtaccgtggcttacctctcccccgagctagttatgggtaagccttccgatgcgcgcagc
gatatttatgccgccggaattatgcttttcgagctgctcaccggtgagcagccattccgt
ggtgaggtgccaattcaggtcgcctatcaacacgtgaattccgtggtgccgccgccctcc
agcgtgctacccggcctggccccagacctggacgaacttgttcgctggtgcacggaatct
gatccagaagatcgcccgcacgatgcaaatgcattacttggtgaactccggcatattcga
acctccctgaccgacgcccaacttgatttcagcggtgatccgaaccgcaccgcggcagtc
cctgcgccgccgtcgttcccgccgagttctgccggactcaccgaagctctcagtagcgcc
gctcagcccaccgagattttcaccgggccgccggcgccgcaagcaacgacaatcatggac
cggcaggtcaatccgaccaccatgatggaacgcccagctccgctgacagtggatacggaa
gacgcgccacgaattagtgcccgagcggcgaaaagcgcgcagaaaaagtccgataaggca
gcagcccgcgaggcagctcgcaatgcttctacgccagtgactactttgcgaaaaggcaac
tcgcggcgcaaaggcatgatctggctggtactagtgctgatcttgattttgctgggcgca
acagctggctggttctttggcttaggcccgggcgccttggctacggtgcccgatttaaaa
gataagacagtcgccgaagcccaagctgaattgagcaagctgggcttcaattcgacgacg
caagccatcgatgatgagacgatcgtccaagatcatgtggtatccagccaacccgcagca
cagagccagcagcgaaagttcctctcggtagtgttgctggtctcgcatgggccgacgctt
tacgcagtcccggcaatggttggtggcagccttgacgcagccaaatctgcacttaactcg
gcgcatatggcccttggcgccgtgacccagcaatacgaagaacagattcctgccggtcaa
gtactgagtcaagatccggcggccaatgtgcagaaacgggctgccacacccatcaacctc
ttggtgtcgcaggggcccaaaccgctaccggtgccagccgtcgtcgggcagactcaggag
gccgcggttaaggcactcaccgacgctggtctcacgcccgtggtggcaaccgatcaggtc
aatgacgccaaggtttcagctggctccatcgtttcgcaagatcccgccaccggaacgctt
agcaagggtggcaaagtaaatctggtggtatccaaagggccgaagatggttaatgtaccc
agctttatcggtaagcaggtggatcaggccgttgaagaacttaaacgcctgaatctgccg
tacaaaatcaacgaaatcctaggcggattctttggcaccgtgagagctcaggacccagtg
aacgtatcggtccctgagggcaccacgatcaacctcaccgtcgtctaa

DBGET integrated database retrieval system