KEGG   Rhodoferax saidenbachensis: RS694_01495Help
Entry
RS694_01495       CDS       T04623                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
rsb  Rhodoferax saidenbachensis
Brite
KEGG Orthology (KO) [BR:rsb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rsb03012]
    RS694_01495
   03029 Mitochondrial biogenesis [BR:rsb03029]
    RS694_01495
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rsb04147]
    RS694_01495
Translation factors [BR:rsb03012]
 Eukaryotic Type
  Elongation factors
   RS694_01495
 Prokaryotic Type
   RS694_01495
Mitochondrial biogenesis [BR:rsb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RS694_01495
Exosome [BR:rsb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RS694_01495
  Exosomal proteins of breast cancer cells
   RS694_01495
  Exosomal proteins of colorectal cancer cells
   RS694_01495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase Lsm_C cobW AAA_29
Motif
Other DBs
NCBI-ProteinID: APW41348
UniProt: A0A1P8K5S3
LinkDB All DBs
Position
308424..309614
Genome map
AA seq 396 aa AA seqDB search
MGKEKFTRTKPHVNVGTIGHVDHGKTTLTAAITTVLAAKFGGSAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLDKYDFPGDKTPIIHGSAKLAME
GDKGDLGEGAIMKLADALDSYIPLPERAVDGAFLMPVEDVFSISGRGTVVTGRIERGVVK
VGEEIEIVGIADTQKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVQRGQVLCKPGS
IKPHTHFTGEIYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGAIELPEGKEMVMPGDNVS
ITVKLINPIAMEEGLRFAIREGGRTVGAGVVAKIIA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagaaaaattcacacgtacgaagcctcacgtcaatgtgggcacgattggccac
gttgaccatggcaagactacgctgacagcggccatcacgaccgtgctggcagccaagttt
ggcggttctgccaaggcttacgaccagatcgacgcagcgcctgaagaaaaagcacgcggt
atcacgatcaacaccgcccacgtggaatacgaaacggctaaccgccactacgcccacgtt
gactgccccggacacgctgactatgtgaagaacatgatcactggcgctgcccaaatggac
ggcgccatcctggtttgctccgcagctgacggccccatgcctcagacccgtgagcacatc
ctgttggctcgccaggtgggtgttccttacatcatcgtgttcctgaacaagtgcgacatg
gtcgatgacgctgaactgctggaactggtcgaaatggaagttcgcgaactcctcgacaag
tacgacttcccaggcgacaagacccccatcatccacggctctgccaagctcgccatggaa
ggcgacaagggtgacctgggtgaaggcgccatcatgaaactggccgacgcactggacagc
tacatccccctgccagagcgtgctgttgacggcgcgttcctgatgcccgtggaagacgtg
ttctccatctctggccgcggcaccgtggtgactggccgtatcgaacgtggtgtggtcaaa
gtcggcgaagaaatcgaaatcgtcggtattgctgacacccaaaagaccacctgcactggc
gtggaaatgttccgcaagctgctggaccaaggtcaagcgggcgacaacgtcggtatcctg
ttgcgcggcaccaagcgtgaagacgtgcagcgcggccaagtgctgtgcaagcccggctcc
atcaagccccacacccacttcactggcgagatctatgtcttgtccaaggacgaaggcggc
cgccacacgcctttcttcaacaactaccgccctcagttctacttccgtacaacggacgtg
accggtgcgatcgagttgccagaaggcaaggaaatggtcatgcctggtgacaacgtgtcg
atcactgtgaagctgatcaaccccatcgccatggaagaaggcctgcgcttcgctatccgc
gaaggtggtcgtaccgtgggcgccggtgtggttgccaaaatcatcgcgtaa

DBGET integrated database retrieval system