KEGG   Rhodoferax saidenbachensis: RS694_02220Help
Entry
RS694_02220       CDS       T04623                                 

Definition
(GenBank) RNA methyltransferase
  KO
K07444  putative N6-adenine-specific DNA methylase [EC:2.1.1.-]
Organism
rsb  Rhodoferax saidenbachensis
Brite
KEGG Orthology (KO) [BR:rsb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RS694_02220
Enzymes [BR:rsb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     RS694_02220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0020 THUMP Methyltransf_31 Methyltransf_25 AviRa MTS
Motif
Other DBs
NCBI-ProteinID: APW41486
UniProt: A0A1P8K669
LinkDB All DBs
Position
455494..456753
Genome map
AA seq 419 aa AA seqDB search
MMQLQLFLPCAAGVEELLAAEVHAATGLMGEDLLTRRGGVLARGSWRDAMLLNLHSRLAQ
RVLVQLSYTEYRNEQDLYRAASEVAWEIWFTPKQSIKVEVTSQHSPLTSLNFAALKIKDA
VCDRFRDKANGVRPDVNTQWPDVRIYAHLTTDSCSLYIDTSGEPLFKRGWREDKGDAPLK
ETLAAAMIAASGWADGDDDLLPLYDPCCGSGTIAIEAAQIACNIAPGSLRRFAFEKFVPF
QPHVWAAIKAEAAAAVVKPEPGQKPLIYGSDVSHRMVDFAQRNAERAGVADVVEFRGGDA
LQRMPPIEGGGVMVLNPPYGERIDVGGVAGVAHEARFGAREAAVTEDGGEFFSQLASHWK
KNYAGWTAWMLTPDLKLPGKMRLKESRRVPMWNGPIECRLFKFSMVAGKMAPKGDVAKS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
ctgatgcaactccaactctttttaccttgcgccgctggtgtcgaggagctgttggccgcc
gaggtgcacgccgccaccggcctgatgggcgaagacctgctgacacgccgtggtggtgtg
ctggcgcgcggctcctggcgcgacgcgatgctgctcaatctgcacagccgcctggcgcag
cgtgtgctggtgcagctctcctataccgagtaccgcaacgaacaagacctgtaccgcgct
gccagtgaggtggcgtgggaaatctggttcacacccaagcaaagtatcaaggtcgaagtc
acgtcgcagcacagcccgctgaccagcctgaacttcgccgcgctcaagatcaaggacgcc
gtgtgcgaccgcttccgtgacaaggccaacggcgtgcgtccggatgtgaacacccaatgg
cccgatgtgcgcatctacgcccacctgaccacggacagttgttcgctgtacatcgacacc
tcgggcgaaccgttgttcaagcgcggctggcgcgaggacaagggcgatgcgccgctgaag
gaaaccctggctgccgcgatgattgccgcaagcggttgggccgatggcgacgacgatctg
ctgccgctgtacgacccttgctgcggcagcggcacgattgcgattgaagcggcgcagatc
gcctgcaacatcgcgcccggatcgctgcgccggtttgccttcgagaagtttgtgccgttt
cagccgcatgtctgggctgctatcaaagccgaagctgccgccgccgtggtgaaaccggag
ccgggtcagaaacctttgatttacggtagcgatgtatcgcaccggatggtggactttgcg
cagcgcaacgccgagcgcgcgggcgtggcggatgttgtcgagttccgtggtggcgacgca
ctgcagcgtatgccccccattgaaggtggcggcgtgatggtattgaacccaccgtacggc
gagcgtattgacgtcggtggcgtggcaggcgttgcacacgaggctcgttttggcgcgcgc
gaagcagcagtcacggaggacggtggcgagttcttcagccagttggccagccactggaag
aagaactacgccggttggaccgcctggatgctcacgcccgacctgaaactgcctggcaag
atgcgtctcaaggagtcgcgccgcgtgccgatgtggaacggcccgattgagtgccgcctg
ttcaagttcagcatggtggcgggcaagatggctcccaagggcgacgtagccaagtcgtga

DBGET integrated database retrieval system