KEGG   Rhodoferax saidenbachensis: RS694_06150Help
Entry
RS694_06150       CDS       T04623                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rsb  Rhodoferax saidenbachensis
Brite
KEGG Orthology (KO) [BR:rsb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RS694_06150
Enzymes [BR:rsb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     RS694_06150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA FAD_oxidored HI0933_like NAD_binding_8 DAO Thi4 AlaDh_PNT_C Glutaredoxin FAD_binding_3 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: APW42154
UniProt: A0A1P8K841
LinkDB All DBs
Position
1287202..1288782
Genome map
AA seq 526 aa AA seqDB search
MLDDTLKAQLAAYLERVTLPIEIVASLGDDDNSVQMRELLQTIQTARADKITVAYDGQDA
RKPSFTLKRAGTATSLRFAGLPLGHEFTSLVLALLWSGGHPPKVEQDVIDQIKALSPVDG
GDFNFEVYMSLTCHNCPDVVQALSLMAVLNPKVKTTVIEGGAFQDEVNAREIMAVPSVYL
NGALFGNGRMLVEEIVAKLDTGAADKDAAKLNAKDPFDVLIVGGGPAGAAAAVYAARKGI
RVGVAAERFGGQVNDTMSIENYISVQETDGPKFAAALEAQTRSYGVDIMNLQRADKIIPA
SEPGGLAEVVLANGGSLKAKTIILSTGARWRNVNVPGEQEYKNKGVAYCPHCDGPLFKGK
DVAVIGGGNSGVEAAIDLAGLVRHVTVFEFMPELKADAVLVKKLHSLPNVTVHTNTQTTE
ITGADGKVNGIKYKNRETGTESLLPLEGVFVQIGLVPNTEWLKGTVDLSKFGEIEVDAKG
HTNVPGVFAAGDCTTVPFKQIVIAAGDGSKAALSAFDHLIRSPIAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgacacactcaaagcccaactcgctgcctacctggaacgcgtgacgctgcct
atcgagatcgtggcgtccctcggtgacgacgacaactccgtgcagatgcgcgagttgctg
caaaccatccagacggcgcgcgccgacaagatcaccgtggcctatgacggccaggacgca
cgcaagccttcgttcacgctcaagcgcgctggcactgccaccagcctgcgttttgccggc
ttgccgctgggccatgaattcacctcgctggtgctggccttgctgtggagcggcggccat
ccgcccaaggtggagcaggatgtgattgatcagatcaaagctttgtctcctgttgatggc
ggagacttcaactttgaggtctacatgagcctcacctgccacaactgccccgacgtggtg
caggcgctaagcctgatggcggtcttgaaccccaaagtgaaaaccaccgtgatcgaaggc
ggcgcgttccaggatgaagtcaacgcccgtgaaatcatggccgtgcccagcgtttacctc
aatggcgcgctgttcggcaatggccgcatgctggtcgaagaaatcgtggccaagctcgac
actggcgcggccgacaaggacgccgccaagctcaatgccaaggatccgtttgacgtgttg
atcgtcggcggcggtcccgccggtgcggcggctgccgtctacgccgcacgcaagggcatc
cgcgtgggtgtggctgcagagcgttttggtggccaggtgaatgacaccatgtctatcgaa
aactatatctcggtgcaagagacggacggccccaagtttgctgccgcactggaggcgcaa
acccgctcctacggcgtggacatcatgaacctgcaacgcgccgacaagatcatcccggcc
tcagagcccggcggcttggccgaagtggtgctcgccaacggtggcagcctcaaggcgaag
accatcatcctctccaccggcgcgcgttggcgcaatgtcaacgtacccggcgaacaggag
tacaagaacaaaggcgtggcctactgcccgcattgcgatggcccgctgttcaagggcaaa
gatgtggctgtgatcggtggcggcaactccggtgtggaagcggccattgatttggccggc
ctggtgcgccacgtgaccgtgtttgagttcatgcccgaactcaaggccgacgccgtgctg
gtgaaaaaactgcacagcttgcccaacgtcaccgtgcacaccaacacgcagaccaccgag
atcaccggtgcggacggcaaggtcaacggcatcaagtacaagaaccgcgagacgggcaca
gagtccctgctgccgctggaaggcgtgtttgtacagattggtctggtgcccaacacggag
tggctgaagggcaccgtggacctgagcaagttcggcgagatcgaagtcgacgccaagggc
cacaccaatgtgccgggtgtgttcgctgcgggcgattgcaccaccgtgccgttcaagcag
atcgtgattgcggcgggggatgggtccaaggcggcgctgagtgcgtttgaccatttgatt
cgctcgcctatcgcggcatag

DBGET integrated database retrieval system