KEGG   Rhodoferax saidenbachensis: RS694_16330Help
Entry
RS694_16330       CDS       T04623                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
rsb  Rhodoferax saidenbachensis
Pathway
rsb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rsb01100  Metabolic pathways
rsb01110  Biosynthesis of secondary metabolites
rsb01130  Biosynthesis of antibiotics
rsb01230  Biosynthesis of amino acids
Module
rsb_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:rsb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RS694_16330
Enzymes [BR:rsb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     RS694_16330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 AAA_17 Cytidylate_kin2 AAA_22 AAA AAA_16 FtsK_gamma Cytidylate_kin KTI12 AAA_5 Thymidylate_kin Viral_helicase1 AAA_28 AAA_24 ADK Ploopntkinase3 CoaE 6PF2K SRP54
Motif
Other DBs
NCBI-ProteinID: APW43946
UniProt: A0A1P8KDB1
LinkDB All DBs
Position
complement(3417860..3418384)
Genome map
AA seq 174 aa AA seqDB search
MIFSLVGLPGSGKTTVGRQLARRLQLPFVDSDHAIEARLGCSIREFFEREGEARFRDIEQ
EVIDALTQETPRVLSTGGGAVLRSANRQHLRSRGRVIYLKSTPEELYRRLRHDVHRPLLQ
VADPLTRMRDLFAERDPLYREAAHFVLETGRPSVATLVNMIVMQLELAGVVPRH
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
ttgatattcagtcttgtcggcctacccggctcaggaaaaaccacggttggacggcagctc
gcgcggcggctgcaacttccctttgttgactcggatcacgcgatagaggcccgtctgggg
tgctctatccgtgagttttttgagcgtgaaggcgaagcgcggtttcgcgacattgagcag
gaagtcattgacgctttgacgcaggagacgcctcgcgttctgtcgaccggtggcggggcg
gtcttgcggtcggcgaatcgacagcatctgcgctccagggggcgtgtcatctatctcaaa
tccacacctgaagagctctatcggcgcttgcggcatgacgtgcaccgccccttgttgcaa
gtggcggatccgctgacccgcatgcgtgacctgtttgccgagcgggacccgttgtaccgg
gaggcggcgcatttcgttctggagacagggcgtccgtcggtggccacgttagtcaacatg
atcgtgatgcagttggagcttgctggcgtggtgccgaggcactga

DBGET integrated database retrieval system