KEGG   Rhodoferax saidenbachensis: RS694_17460Help
Entry
RS694_17460       CDS       T04623                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rsb  Rhodoferax saidenbachensis
Pathway
rsb00071  Fatty acid degradation
rsb00280  Valine, leucine and isoleucine degradation
rsb00281  Geraniol degradation
rsb00310  Lysine degradation
rsb00360  Phenylalanine metabolism
rsb00362  Benzoate degradation
rsb00380  Tryptophan metabolism
rsb00410  beta-Alanine metabolism
rsb00627  Aminobenzoate degradation
rsb00640  Propanoate metabolism
rsb00650  Butanoate metabolism
rsb00903  Limonene and pinene degradation
rsb00930  Caprolactam degradation
rsb01100  Metabolic pathways
rsb01110  Biosynthesis of secondary metabolites
rsb01120  Microbial metabolism in diverse environments
rsb01130  Biosynthesis of antibiotics
rsb01212  Fatty acid metabolism
Module
rsb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rsb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    RS694_17460
   00650 Butanoate metabolism
    RS694_17460
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RS694_17460
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RS694_17460
   00310 Lysine degradation
    RS694_17460
   00360 Phenylalanine metabolism
    RS694_17460
   00380 Tryptophan metabolism
    RS694_17460
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RS694_17460
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RS694_17460
   00281 Geraniol degradation
    RS694_17460
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RS694_17460
   00627 Aminobenzoate degradation
    RS694_17460
   00930 Caprolactam degradation
    RS694_17460
Enzymes [BR:rsb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RS694_17460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: APW44137
UniProt: A0A1P8KDM6
LinkDB All DBs
Position
complement(3660193..3661017)
Genome map
AA seq 274 aa AA seqDB search
MNKAVETLVQGPVTIVTLQRPDVRNAVDADTAQQLYAAFSAFEADASARVAVFHGAHGHF
CAGWDLQAGARMAQQMQADVDPFATLDFSANDYGAPATPSGPAGPMGPSRLVLTKPVIAA
ISGAAVAGGMELALWCDMRVMEEDAYFGVYCRRFGVPLIDGGTVRLPRLIGMGHAMDLIL
TGRKVEAAEALQMGLCSRVVPTGQALRAAVQLAEQIAAFPQKTMLADRASAYAQWDLPLP
QALHQEWQRGKACIAEGLQGAGRFAAGAGRHGKF
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagccgtagaaaccctagtgcaaggcccagtcaccatcgtgacattgcagcgc
cccgacgtgcgcaacgctgtggacgccgacactgcgcagcagttgtatgccgcattttcc
gcattcgaggccgatgcctcggcgcgcgtggcggtgttccacggcgcacacggacacttt
tgtgcgggctgggatttgcaggctggtgcgcgcatggcgcagcagatgcaggcagacgtt
gatccatttgccacattggatttttccgccaatgactacggtgcacctgctacgccgagc
ggacctgcgggaccgatgggcccttcgcggctggtgctcaccaaaccggtcatcgccgcc
atcagtggcgccgcagtggcgggcggcatggagttggcgttgtggtgcgacatgcgcgta
atggaagaagacgcctacttcggtgtgtattgccgccgctttggtgtgccgttgatcgat
ggcggcacggtgcgtctgccgcgcctcattggcatgggccacgcgatggacctgatcctc
accgggcgcaaagtggaagcggccgaggccttgcagatgggcctgtgcagccgtgtggtg
cccacgggtcaggccctgcgggctgcggtgcaacttgccgagcagatcgccgccttcccg
caaaaaaccatgctggctgaccgtgccagcgcctacgcgcagtgggacctgccgctgcca
caggcactgcaccaggagtggcaacgcggaaaggcatgtattgccgaagggctgcaaggg
gcggggcgctttgcagcaggtgcggggcggcatggtaagttttga

DBGET integrated database retrieval system