KEGG   Rhodoferax saidenbachensis: RS694_19495Help
Entry
RS694_19495       CDS       T04623                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rsb  Rhodoferax saidenbachensis
Brite
KEGG Orthology (KO) [BR:rsb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rsb01001]
    RS694_19495
Enzymes [BR:rsb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     RS694_19495
Protein kinases [BR:rsb01001]
 Serine/threonine kinases: Other
  Bacterial family
   RS694_19495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase CHASE2 Pkinase_Tyr Pkinase_fungal Kdo APH
Motif
Other DBs
NCBI-ProteinID: APW44486
UniProt: A0A1P8KEU3
LinkDB All DBs
Position
complement(4123565..4126252)
Genome map
AA seq 895 aa AA seqDB search
MAKSSSSKAQSFWRTDWFAGVAIVFAAMALHIGTDFIGTMERRFYDFASTSTSRQPSDRI
AVIAIDDQSVANIGRWPWPRDVHAKLIDLLAAAKAKTIVHTAFFFEPQVDPGLIFIRKMK
AALGASGDAGSNNEQVGKLIAEAEVALDTDAVLAASMQNAGNVLVPSVFTLGEQQGKPDN
PLPPYALKSALDENNGFSISATRGQQPIESIGNAAAGIGHLNQFPDVDGAVRLEPLLVNY
YGKAVPSMALLAAVKSLNLASSDIRLNAGESVQIGKLRVKTDEAALMLPQFYKGKDGKPA
FAVDSFYDVLTGKIPASKYADKIVIVGATAAGVGVQFPVPGNPALSPAETIAHITSSILN
EHFIVQPVWGIWATLAVFLLVAAYVVVALPRLSAGMAAGVTLTLFVALLVVEFGMLSAAA
TWLKLVFPATVLVLGHLALTTKRFLMTEAGKVKADEESAETNRMMGLALQGQGQLDMAFD
RFRRVPMNDAVMGNLYSLALDFERKRQFNKAESVYEHMAAFDNNYKDIKSKLSRAKNLSE
TVMLGGGGGHPGGTMLLDGGAVEKPMLGRYQVEKELGKGAMGVVYLGKDPKIGRVVAIKT
MALSQEFAGEELTDARERFFREAETAGRLQHQNIVTIFDAGEEHDLAYIAMEFLKGKDLV
DFCKGDHLLPVPVVLSIVARVAEALSYAHKQNVVHRDIKPANIMYEVESDTVKVTDFGIA
RITDSSKTKTGLVLGTPSFMSPEQLAGKKVDGRSDLYSLGVMLFQMLAGVLPFRGDSMAE
LMFKIANEEAPDVRVIRPELSETLANIVALALSKRPETRYQDGDQFAADLRGAMEGATAA
RAGGSGGGVQITDAGGKADFSATLPAMQAVYDKTTVQVARKPDSEEAGGATDLEI
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaatcttcttcatctaaggcgcagtctttttggcgtacagactggtttgccggc
gtggcaattgtctttgctgccatggccctgcatatagggactgacttcatcggcacgatg
gagcgtcgtttttacgactttgccagcaccagcacctcccgccagccctcggatcggatc
gccgtcattgccattgatgaccagagtgttgccaatattggtcgctggccttggccacgc
gatgtgcatgccaagctgattgacctgctggcagctgccaaggccaaaaccatcgttcat
acggcttttttctttgagcctcaggttgatcccggtcttatatttatccgaaaaatgaag
gctgcattgggcgcttctggagatgccggctcgaacaatgagcaggttggcaagttgatt
gccgaggcggaagtggcactggatacggatgctgtgcttgcagccagtatgcaaaacgca
ggcaatgtattagtgccatcggtttttacgctgggggagcagcagggcaagcctgacaac
cccctgccgccttacgcgctgaaaagtgcgctggatgaaaacaatggattttccatttcc
gccacgcgggggcagcagcccatcgagagtattggaaacgcagcagctggcattgggcat
ttgaaccagtttcctgatgtggatggtgccgttcggctcgaacctttgctggtgaattac
tacggtaaagcggttccctccatggccttgctggctgcggtgaaaagcctgaatctggct
tccagcgacatccgactcaatgcgggtgagtctgtgcagatcggcaaactccgagtcaaa
accgatgaggcagcccttatgttgccccagttctacaaaggaaaagatggcaagccggct
tttgcggtggactctttttacgatgtgctcaccggcaaaattccggcaagcaagtacgcc
gacaaaatcgtcatcgttggcgctacggcagcaggcgtgggcgtgcaatttccggtgcct
ggcaatccggccctgtcacccgcggagaccattgcgcacatcacctccagcatcctgaat
gagcactttattgtccagccggtttggggtatctgggccaccttggcggtatttctgttg
gtggcggcctatgtcgtggttgcgctcccgcggctgtcggccggtatggcggcaggtgtc
actctgaccctgtttgttgccttgctcgtcgtggagtttggcatgctctcggctgctgcg
acctggctgaagctcgtgtttcctgccaccgtcctggtgctagggcatttggcgttgacc
accaagcgcttcctgatgacagaggctggcaaggtgaaggcagacgaagagtcggccgaa
acaaaccgcatgatgggtctggcactgcagggccaagggcagttggacatggcgtttgac
cgttttcgccgggtccccatgaacgatgccgtcatgggcaatctgtacagcctggcgttg
gactttgagcgcaagcgccagttcaacaaagccgagtcggtttatgaacacatggctgcg
tttgacaataactacaaagacatcaagtccaaactcagccgcgccaagaatttgtcggaa
accgtcatgttgggtggtggcggtggtcaccccggcggcaccatgctgctggatggcggt
gcggtggagaaacccatgctgggccgctaccaggttgaaaaagagctgggcaagggagcc
atgggggtggtgtatctgggcaaagaccccaagattggccgtgttgtcgccatcaagacc
atggctttgagccaggagtttgccggcgaggagctcacggacgcacgcgagcgctttttc
cgcgaggcagagaccgccgggcgactgcagcaccagaacatcgtgactatctttgatgcg
ggtgaagagcatgacctggcctacatcgccatggaattcctcaagggcaaggaccttgtc
gatttctgcaagggtgaccatttgctgcccgtccccgtggttttgagtatcgtggcccgg
gtggccgaggcgctgtcctatgcccacaaacaaaacgtcgtgcaccgggatatcaagcct
gccaacatcatgtacgaggtggagagcgataccgtcaaggtgacagacttcggtattgcc
cgcattacggactccagcaagaccaagacggggctcgtgctgggcacgccaagcttcatg
tcgccggagcaactggcgggcaaaaaggtggacggccgctcagacctttattcattgggc
gtcatgctgtttcaaatgctggccggtgttttacccttccgcggagactccatggcggag
ttgatgttcaagatcgccaatgaggaagcgccggatgtgcgcgtgattcggccggagttg
tcggaaacgctggccaatattgttgcgcttgctttgagcaagcgtccggagacgcgttac
caggatggagatcagtttgccgctgacttgcgaggtgccatggaaggcgcgactgccgcg
cgagctggcggttcaggcggtggtgtgcagatcacggacgccggaggcaaggccgacttt
tctgcgacgctccctgccatgcaggctgtttacgacaagacgacggtgcaagtggccagg
aagccggactccgaggaagctggcggcgcaacggatctggaaatctaa

DBGET integrated database retrieval system