KEGG   Rhodoferax saidenbachensis: RS694_20060Help
Entry
RS694_20060       CDS       T04623                                 

Definition
(GenBank) hydroxypyruvate isomerase
  KO
K22131  2-dehydrotetronate isomerase [EC:5.3.1.35]
Organism
rsb  Rhodoferax saidenbachensis
Brite
KEGG Orthology (KO) [BR:rsb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RS694_20060
Enzymes [BR:rsb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.35  2-dehydrotetronate isomerase
     RS694_20060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: APW45019
UniProt: A0A1P8KG78
LinkDB All DBs
Position
complement(4241071..4241910)
Genome map
AA seq 279 aa AA seqDB search
MPRFAANLSLMYTEVPFLDRFEAAEQDGFTAVEFLFPYAWAPQDLAQRLQAHGLQQVLLN
APPGGADRASMATAWDRGERGTACLPGREAEFRAGVQEALLYAQALQCPRIHVMAGLAPQ
GVSPEVLLATYVANLRWAAQQAAKAGCAVLIEPINPRDMPGYYLQRQDHAHAVVQAVAEP
ALKVQMDLYHCQIVEGDVATKLRHYLPTGAVAHIQMAGVPERQEPDAGELHFPYLLDLID
SLGYTGWVGCEYRPRLGAQPGATRTGLGWMAAYRSAAHR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgccccgttttgccgccaacctgagtctgatgtacaccgaggtcccgtttctggaccgg
tttgaagccgccgagcaggatggtttcacggcggtggagttcctcttcccttacgcctgg
gcgccgcaggacctcgcgcagcggttgcaggcgcatggattgcagcaggtgctgctcaac
gctccgccgggtggcgcagaccgtgcgtccatggccacggcgtgggaccgcggcgagcgt
ggcacggcctgcctgcccgggcgcgaggcggaattccgtgccggtgtacaggaggcgctg
ctctacgcccaagcgctgcaatgcccgcgcatccacgtcatggcgggtctggcgccgcag
ggtgtcagcccggaggtgttgttggcaacctatgtagccaacctgcgctgggccgcacaa
caggcggcgaaggccggttgcgcggtgctgatcgagccaatcaatccgcgcgacatgccg
ggctactacctgcaacgccaggaccacgcccacgccgtcgtgcaagcggttgcggagccc
gcgctcaaggtgcagatggacctgtaccactgccagatcgtggaaggcgacgtggccacc
aagctgcgccactacctgcccacgggtgccgtggcccatatccagatggccggtgtgccg
gagcgccaggaacccgatgcgggtgagttgcatttcccctaccttttggatctgatcgac
agcctgggctacaccggctgggtgggctgtgagtaccggccccgcttgggtgcgcagccg
ggtgccacacgcacgggcttggggtggatggccgcgtaccgtagcgcggcgcaccgttag

DBGET integrated database retrieval system