KEGG   Ralstonia solanacearum CFBP2957: RCFBP_10869Help
Entry
RCFBP_10869       CDS       T01272                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rsc  Ralstonia solanacearum CFBP2957
Brite
Enzymes [BR:rsc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     RCFBP_10869 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CBJ42172
UniProt: D8NPQ6
LinkDB All DBs
Position
906399..906977
Genome map
AA seq 192 aa AA seqDB search
MAHTLPPLPYALDALAPHISKETLEFHYGKHHQTYVTNLNNLIPGTEFENLSLEDIVKKS
SGGLFNNAAQVWNHTFYWNGLKPNGGGAPTGALADAINAKWGSFDKFKEEFTKTAIGTFG
SGWAWLVKKADGTLDLVSTSNAATPLTTDAKPLLTCDVWEHAYYIDYRNARPKYVEAFWS
LVNWDFVANNFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcccacacgctccccccgctgccgtacgcgcttgacgccctggcgccgcacatctcc
aaggaaaccctggagttccactacggtaagcaccaccagacctacgtcacgaacctgaac
aacctgatcccggggaccgagttcgagaacctgagcctggaagacatcgtcaagaagtcc
tcgggcggccttttcaacaacgccgcgcaggtgtggaaccacacgttctactggaacggc
ctgaagccgaacggcggcggcgctccgaccggcgcgctggctgacgccatcaacgccaag
tggggcagcttcgacaagttcaaggaagagttcaccaagacggccatcggcaccttcggt
tcgggctgggcctggctggtgaagaaggccgacggcacgctggacctggtgtccacctcc
aacgccgccacgccgctgacgacggacgccaagccgctgctgacctgcgacgtgtgggaa
cacgcctactacatcgactaccgcaacgcccgtccgaagtacgtcgaggcgttctggagc
ctggtcaactgggatttcgtcgcgaacaacttcgcctga

DBGET integrated database retrieval system