KEGG   Ralstonia solanacearum CFBP2957: RCFBP_11053Help
Entry
RCFBP_11053       CDS       T01272                                 

Gene name
sodC
Definition
(GenBank) Superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
rsc  Ralstonia solanacearum CFBP2957
Brite
Enzymes [BR:rsc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     RCFBP_11053 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: CBJ42352
UniProt: D8NR08
LinkDB All DBs
Position
1089481..1090029
Genome map
AA seq 182 aa AA seqDB search
MKQLVIGLAAIGLMAGCASNAGTGASTGTPAAGMSASATLAPKSGSNAQGTIKLLQQGDN
RVAMAVDIAGLPPNGMFGFHVHEKGDCSAPDGMSAGGHFNPTGQPHGDPRSGPHHAGDIP
MLQSDASGKAVGSIVLNGVTLAPGPTSLVGHAVIVHSGMDDYKTQPTGNSGGRIACGVIV
AN
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactcgtgatcggacttgccgcgatcggcctgatggccggctgcgcctcgaat
gccggcaccggcgccagcaccggcacgcccgccgctggcatgtcggcttcggccacgctg
gcgcccaagagcggcagcaacgcgcaaggcaccatcaagctgctgcagcaaggcgacaac
cgggttgcgatggcggtcgacatcgcgggcctgccgcccaacgggatgttcggcttccac
gtgcacgagaagggcgactgctccgcgccggacggcatgagcgcgggcgggcacttcaac
ccgaccggccagccgcacggcgatccgcgctccggtccgcaccatgccggcgacattccg
atgctgcaatccgacgccagcggcaaggccgtcggctcgatcgtcctgaacggcgtcacg
ctcgcgcccggcccgaccagcctggtcggccacgcggtgatcgtccattcgggcatggac
gactacaagacccagccgaccggcaactccggcgggcgcatcgcctgcggcgtgatcgtg
gcgaactga

DBGET integrated database retrieval system