KEGG   Ralstonia solanacearum CFBP2957: RCFBP_11073Help
Entry
RCFBP_11073       CDS       T01272                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
rsc00620  Pyruvate metabolism
rsc00680  Methane metabolism
rsc01100  Metabolic pathways
rsc01120  Microbial metabolism in diverse environments
rsc01200  Carbon metabolism
Module
rsc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RCFBP_11073 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    RCFBP_11073 (ppc)
Enzymes [BR:rsc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     RCFBP_11073 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase AAA_22 PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CBJ42372
UniProt: D8NR28
LinkDB All DBs
Position
complement(1113971..1116931)
Genome map
AA seq 986 aa AA seqDB search
MTQPAARRASARATPARKTPTATASQAAKALAAHGAAGTTLGPTSRRSSGSAAAKDQPLK
EDIRFLGRLLGDVLREQEGAAAFETVETIRQTAVRFRRDGDRQAEQELDRLLKTLSRDQT
TSVVRAFSYFSHLANIAEDQHHNRRRRVHALAGSPPQPGSLLRALLSAADEGLSGEALRR
FFDAALIVPVLTAHPTEVQRKSILDAQREIARLLAERDAPLTARERERNTTLLRAHVTKL
WQTRMLRTTRLMVADEIENALSYYQTTFLREIPALYRELEEDVATVFPRRGARGEPATLP
AFFQMGSWIGGDRDGNPFVTAQTLRHAARRQASVILTWYLDEIHALGAELSMSTSLVDVS
AELLALAARSPDHSEHRADEPYRRALIGVYARLAATCRELTGEDAGRHAVGPAPAYTSPE
DLRADIQIVIDSLAAHHGEALADARLTSLARAIDVFGFHLASIDLRQVSDVHEATVAELL
KVAGVEGAYAALSEADKRALLLRELQQPRLLTLPFHTYGETTASELEIFRAAREARARYG
SRIVRNYIISHTETLSDLLEVMLLQKESGMFRHGANGSGSAGLDVMVIPLFETIEDLRNA
PQIMGDLLALPGFDAVLAAQGNEQEVMLGYSDSNKDGGFLTSNWELYKAELALVDLFERH
GVRLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEIISSKFANPEIGRRNL
ETIVAATLEATLLPTRNRPKGLEEFEAAMQALSDHAFSAYRNLVYETPGFKDYFFATTPI
TEIADLNLGSRPASRKLMDKKQRRIEDLRAIPWGFSWGQCRLLLPGWFGFGSAVQRWLDE
AGSAKAKAARLATLKRMYKQWPFFANLLSNMDMVLSKADLHVASRYAQLCDDRKLRNAVF
SRISAEFTLTGQMLAAITGQSERLADNPLLARSIKNRFPYLDPLNHLQVELLKRFRSGKA
GSNDARVRRGIHLSINGIAAGLRNSG
NT seq 2961 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcccgccgcgcgccgcgcttccgcgcgcgcgacccccgcgcgcaagacgccc
accgccaccgccagccaggccgccaaggccctcgccgcccatggcgcggccggcacgacc
ctcggccccacctcgcgccgctcttccggcagcgcggcggccaaggaccagccgctcaag
gaagacatccgcttcctcgggcgcctgctgggcgacgtgctgcgggaacaggaaggcgcc
gccgccttcgagaccgtcgagaccatccgccagaccgcggtgcgcttccgccgcgacggc
gaccgccaggccgaacaggagctcgaccggctgctcaagacactgtcgcgcgaccagacc
acctcggtggtgcgcgccttcagctacttctcgcacctggccaatatcgccgaagaccag
caccacaaccgccgccgccgcgtgcacgcgctggccggttcgccgccgcaacccggcagc
ctgctgcgcgcgctgctgtcagcggccgacgagggtctgtcgggcgaggcgctgcggcgc
ttcttcgatgccgcgctgatcgtgccggtgctcaccgcccacccgaccgaggtgcagcgc
aagagcatcctcgatgcgcagcgcgagatcgcccgcctgctggccgagcgcgacgccccg
ctcaccgcgcgcgagcgcgaacgcaataccaccctgctgcgggcccacgtcaccaagctg
tggcagacgcgcatgctgcgcaccacgcgcctgatggtggccgacgagatcgagaacgca
ctgtcgtactaccagaccaccttcctgcgcgagattcccgcgctgtaccgcgagctggaa
gaggacgtcgccacggtgttcccgcgccggggcgcgcgcggcgaaccggctacgctcccc
gccttcttccagatgggctcgtggatcggcggcgaccgcgacggcaacccgttcgtcacc
gcgcagacgctgcgccatgccgcgcggcgacaggccagcgtgatcctcacgtggtacctg
gacgagatccatgcgctgggcgcggagctgtcgatgtcgacctcgctggtcgacgtgagc
gccgaactgctggccctggccgcgcgctcgcccgaccactccgagcatcgtgcggacgag
ccctaccggcgcgcgctgatcggcgtgtatgcgcgcctggcggccacctgccgcgagctg
accggcgaggatgccggccgccacgccgtcggccccgccccggcctacacgagcccggag
gacctgcgcgccgatatccagatcgtcatcgattcgctggcggcgcaccatggcgaagcg
ctggccgatgcgcggctgacctcgctggcgcgggcgatcgacgtgttcggcttccacctg
gcgtcgatcgacctgcgccaggtttcggacgtgcacgaagccaccgtggccgagctgctc
aaggtggccggcgtggaaggcgcctacgcggcgctgtcggaagccgacaagcgcgcgctg
ctgctgcgcgagctgcaacagccgcgcctgctgacgctgcccttccacacctacggcgag
acgaccgcgtcggaactcgagatcttccgcgccgcgcgcgaggcgcgcgcgcgctacggc
agccgcatcgtgcgcaactacatcatctcgcacaccgagacgctatcggacctgctggaa
gtgatgctgctgcagaaggagtcgggcatgttccgccacggcgccaacggcagcggcagc
gcgggcctggatgtgatggtgatcccgctgttcgagaccatcgaagacttgcgcaacgcg
ccgcagatcatgggcgacctgctggcgctgcccggcttcgatgccgtgctcgccgcgcag
ggcaacgagcaggaggtgatgctcggctattcggattccaacaaggacggcggcttcctc
acctccaactgggagctgtacaaggccgagctggcgctggtggacctgttcgagcgccac
ggcgtgcgcctgcgcctgttccacggccgcggcggcacggtggggcgcggcggcggcccg
acctaccaggccatcctgtcgcagccgccgggcacggtgaacgggcagatccgcctgacc
gagcagggcgagatcatctccagcaagttcgccaaccccgagatcggccggcgcaacctg
gagaccatcgtggccgccacgctcgaggcgacgctgctgcccacgcgcaaccggcccaag
gggctggaggaattcgaggccgcgatgcaggcgctgtcggaccatgcgttctcggcctac
cgcaacctcgtctacgagaccccgggcttcaaggactacttcttcgccaccacgcccatc
accgagatcgccgacctgaacctcggctcacggccggcctcgcgcaagctgatggacaag
aagcagcgccgcatcgaagacctgcgcgcgatcccgtggggcttctcgtggggccagtgc
cggctgctgctgccgggctggttcggcttcggcagcgcggtgcagcgctggctggacgag
gcgggcagcgccaaggcgaaggcggcccgcctggccacgctcaagcgcatgtacaagcaa
tggccgttcttcgccaacctgctctccaacatggacatggtgctgtccaaggccgacctg
cacgtggcctcgcgctatgcccagttgtgcgacgaccgcaagctgcgcaatgcggtgttc
tcgcgcatctcggcggaattcacgctcaccgggcagatgctggcggccatcaccggccaa
tcggaacggctggccgacaacccgctgctggcgcgctcgatcaaaaaccgtttcccgtac
ctcgatccgctcaaccacctgcaggtggaactgctcaagcggttccgctcgggcaaggcg
ggcagcaacgatgcgcgggtgcggcgcggtatccacctgtcgatcaacgggatcgcggcg
gggctgcgcaacagcggctaa

DBGET integrated database retrieval system