KEGG   Ralstonia solanacearum CFBP2957: RCFBP_20673Help
Entry
RCFBP_20673       CDS       T01272                                 

Gene name
aroG
Definition
(GenBank) 3-deoxy-7-phosphoheptulonate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
rsc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rsc01100  Metabolic pathways
rsc01110  Biosynthesis of secondary metabolites
rsc01130  Biosynthesis of antibiotics
rsc01230  Biosynthesis of amino acids
rsc02024  Quorum sensing
Module
rsc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:rsc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RCFBP_20673 (aroG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    RCFBP_20673 (aroG)
Enzymes [BR:rsc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     RCFBP_20673 (aroG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: CBJ43859
UniProt: D8NMP3
LinkDB All DBs
Position
complement(2632558..2633676)
Genome map
AA seq 372 aa AA seqDB search
MNRIDNPQSDQEVGVADATQDTTRIDDVRIGAVRPLISPALLLDELPVSPAVQAHVEASR
AAVTDILRGRDDRLIAVVGPCSIHDHDQAIEYAHRLRVAADRLRDDLLIVMRVYFEKPRT
TVGWKGYINDPRLDGSFRINEGLRRARQLLLEVNALGLPTATEFLDLLSPQYIADLVAWG
AIGARTTESQSHRQLASGLSCPIGFKNGTDGGVQIAADAILAARSSHSFMGMTKMGMAAI
FETRGNSDAHVILRGGKSGPNYDAVAIEGSCAILRAAGLREQVMVDCSHANSGKSHARQV
EVAQDVAQQLSSGDRRIIGVMIESHLEEGRQDLKPGLALRRGVSITDACLGWSQTEPLLD
TLAAAARTRRQG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcgcatcgacaatccccaaagcgaccaagaagtcggcgtggccgacgccacccag
gatacaacccgcatcgatgatgtgcgtatcggcgcagtccgtccgctcatttctccggcc
cttctgctcgacgagttgccggtgtcgcccgcggtacaggcacacgtcgaagcgagccgg
gccgcggtcacggacatcctgcgcggtcgggacgatcgcctgatagccgtggtggggccg
tgctcgatccacgaccatgaccaagccatcgagtacgcgcatcggctcagggtggccgcg
gatcgcctgcgcgacgatctgctgatcgtcatgcgcgtgtacttcgaaaagccgcgcacg
accgtcggctggaaggggtacatcaacgatccgcgactcgacggcagcttccggatcaac
gaagggcttcgccgcgcgcgccaattgctgctggaggtcaatgcgctggggttgccgacg
gccaccgagtttcttgacctgctgagcccgcagtacattgctgacctggttgcatggggg
gcgatcggcgccaggacgacggaaagccagagccatcgacagctcgcctcggggctgagc
tgtcccatcggattcaagaacggcacggacggtggtgtccagattgcggcggatgcgatc
ctggccgcgcgctcgagccattcgttcatgggcatgacgaagatggggatggccgcgatt
ttcgagacgcgcggcaacagcgatgcacacgtcattctgcgtggcggcaagagcggcccg
aactatgacgcggtggccattgaaggcagctgcgcgatccttcgggcggcggggctgcgc
gagcaggtgatggtcgactgttcacatgcgaactcgggcaagtcgcatgcccgtcaggtc
gaagtggcgcaagacgtggcgcagcaactctcatccggcgatcggcgcatcatcggcgtg
atgatcgagagccatctggaggaagggcgccaggatctgaaaccaggcttggcattgcgg
cgcggcgtgtccatcaccgatgcctgccttggctggtcccagacggaaccgctgctggac
acgcttgccgcggcggcgcgcacgcggcggcaaggctag

DBGET integrated database retrieval system