KEGG   Ralstonia solanacearum CFBP2957: RCFBP_20893Help
Entry
RCFBP_20893       CDS       T01272                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rsc  Ralstonia solanacearum CFBP2957
Pathway
rsc03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    RCFBP_20893
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rsc03400]
    RCFBP_20893
Enzymes [BR:rsc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     RCFBP_20893
DNA repair and recombination proteins [BR:rsc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     RCFBP_20893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M mRNA_cap_enzyme DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: CBJ44073
UniProt: D8NP23
LinkDB All DBs
Position
2833756..2836368
Genome map
AA seq 870 aa AA seqDB search
MPGPLDAYRRQRDFSQTREPGGKRRATGRRGNGTLRYVIQKHDATHLHYDFRLELDGTLK
SWAIPKGPSLDPADKRLAVHVEDHPLDYADFEGHIPEGQYGAGDVIVWDRGTWRPHGDAR
AAYRAGKLKFDLDGEKLHGAWTLVRTRLPGSGRHPKEQWLLIKERDAQVRPSGEYDITQA
LPASVISGREVEGDPPAPQPASQMPAPTTPAADAVRPPAGAVPAPLPAALEPQLATLVGT
PPTSGTWDYEAKFDGYRILARIDGDRVQLFSRNGHDWTARLPRQARALPALGLRNAWLDG
EAVVMNAAGVPDFQALQNAFETAHLERIRYVLFDLPYCNGMDLRGVPLRERRALLERIIG
AASDALDHKAIAFSNRLDAPPGPLLASACRLSMEGIIGKRADAPYHAGRSRAWIKLKCGR
RQAFVIGGYSAPKGSRSSLGALLLGVYDDDGALRYAGRVGTGFNQASLRALHAELRGLRT
DRPPFADPPAGAGARDVRWVRPERVAEVAFAQWTREGIVRQAVFQGLRDDKPARGIVRES
ANRASAGSRPNGPDPDDPASAAQPARRTRPGAERIAGVDITHPDRVIETASGTTKADLAR
YYAAIADWILPHLRNRPVALLRAPDGIDGEHFFQKHIAAPQIPGITRLDPSLDPGHASLL
TIDSVEALIGAVQMGAVEFHTWNARADRIEQPDRIVFDIDPDPALPFARVIEATQLTLAL
LDELGLRAFLKTSGGHGLHVVVPLARRASAGWDTLKAFAQAVTQHLARTIPARFAARMGP
QNRIGKTFVDYLRNHRGASTVAAGSVRARPGLPVSVPIARDELAGLHSAAQWNLRTLPDR
LATLKADPWADYARTRQSVTADMRRRIGLG
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgcccggaccgctcgacgcctaccgccgccagcgcgatttctcgcagacccgcgaaccc
ggcggcaagcgccgcgccaccggccggcgcggcaacggcaccctgcgctacgtgatccag
aagcacgacgccacgcacttgcactacgacttccgccttgagctggacggcacgctcaag
agctgggccatccccaagggcccgagcctggacccggccgacaagcgcctcgccgtgcat
gtggaagaccatccgctcgactacgcggacttcgagggccatatccccgagggccagtac
ggcgccggcgatgtgatcgtctgggaccggggcacttggcgcccgcacggcgacgcacgc
gccgcctaccgcgccggcaagctgaagttcgacctcgacggcgagaagctgcacggcgcc
tggaccctggtgcgcacgcgcctgcccggcagcggccggcacccgaaggagcaatggctg
ctgatcaaggagcgcgacgctcaggtccggccatccggcgaatacgacatcacgcaggcg
ctgccggccagcgtcatcagcggcagggaggtcgaaggcgacccgcccgcgcctcaaccg
gcatcgcagatgcccgcgccgaccacgccggccgccgacgccgtgcggccgcctgccggc
gccgtccccgcgccgctgcccgccgcgctggagccgcagctcgccacgctggtcggcacc
ccgcccacctcgggcacgtgggactacgaagccaagttcgacggctaccgcatcctcgcg
cgcatcgacggcgaccgcgtgcaactgttcagccgcaacgggcacgactggaccgcccgc
ctgccacgccaggcacgcgcgctgcccgcgctggggctgcgcaacgcctggctggacggc
gaggcggtggtgatgaacgcagccggcgtgccggatttccaggcgctgcagaacgctttc
gagaccgcgcacctggagcgcatccgctacgtcctgttcgacctgccgtactgcaacggc
atggacctgcgcggcgtgccgctgcgcgagcggcgcgcgctgctggagcgcatcatcggg
gcggcgtccgatgcgctcgaccacaaggccatcgcgttctccaaccggctggatgcgccg
cccggcccgttgctggcctcggcctgccgcctgtcgatggagggcatcatcggcaagcgc
gccgacgcgccctaccacgctggacgcagccgggcctggatcaagctcaagtgcggccgg
cgccaggcattcgtcatcggcggctacagtgcgcccaagggcagccgcagcagcttgggc
gcactgctgctgggcgtgtatgacgatgacggtgcgctgcgctacgccggacgggtcggc
accggattcaaccaggccagcctgcgcgcgctgcacgcagaactgcgcggactgcgcacg
gaccgcccgcccttcgccgacccgcccgccggcgccggcgcgcgcgacgtgcggtgggtg
cggcccgagcgcgtggccgaagtcgccttcgcccaatggacgcgcgaaggcatcgtgcgg
caggccgtcttccagggcctgcgcgatgacaaacccgcgcgcggcatcgtgcgggagagc
gcgaaccgcgccagcgccgggtcccgcccgaacggccccgacccggacgatcccgcatcc
gcagcgcagcccgcgcgccggacgcgcccgggtgccgagcgcatcgccggtgtcgacatc
acgcatccggaccgcgtcatcgaaacagcgagcggcaccaccaaggccgacctcgcgcgc
tactacgccgccatcgcggactggatcctgccgcacctgcgcaaccggccggtggccctg
ctgcgcgcgccggacggcatcgacggcgagcacttcttccagaagcacatcgccgcgccg
cagatccccggcatcacccgactcgacccctcgctcgatcccgggcatgcgtcgctgctg
acgatcgattcggtggaggcgctgatcggcgcggtgcagatgggcgcggtggaattccac
acctggaatgcgcgggccgatcgcatcgagcagcccgaccgcatcgttttcgacatcgac
cccgaccccgcgctgccgttcgcgcgcgtgatcgaggccacgcagttgacgctggcgctg
ctcgacgagctgggcctgcgcgccttcctgaagaccagcggcggccacggcctgcacgtg
gtggtgccgctcgcgcggcgcgcgtcggccggctgggacacgctcaaagccttcgcgcag
gccgtgacgcaacacctggcccgcaccattccggcccgcttcgccgccaggatggggccg
cagaaccgcatcggcaaaacgttcgtcgactacctgcgcaaccaccgcggcgccagcacg
gtagcggcaggctcggtgcgggcgcggcccggcctgccggtctccgtaccgatcgcgcgc
gatgagctggcggggctgcattcggccgcgcaatggaacctgcgcacactgccggatcgc
ctcgccaccctgaaggcagacccctgggccgactacgcccgcacccggcaatcggtgacg
gccgacatgcggcgccgcatcggtctcggctga

DBGET integrated database retrieval system