KEGG   Ralstonia solanacearum FQY_4: F504_1414Help
Entry
F504_1414         CDS       T02751                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
rse00473  D-Alanine metabolism
rse01100  Metabolic pathways
rse01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rse00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    F504_1414
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    F504_1414
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rse01011]
    F504_1414
Enzymes [BR:rse01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     F504_1414
Peptidoglycan biosynthesis and degradation proteins [BR:rse01011]
 Precursor biosynthesis
  Racemase
   F504_1414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AGH83930
UniProt: M4UTL4
LinkDB All DBs
Position
1474705..1475832
Genome map
AA seq 375 aa AA seqDB search
MPRPIQAVIHGPALANNLQVVRRHAADSRVWAVIKANAYGHGIERAYEGLRQADGFGLLD
LDEAVRLRQLGWQGPILLLEGFFKPEDLALVEQYRLTTTVHCEEQLRMLELARLKGPVSI
QLKINTGMSRLGFAPAAYRAAWEHARAISGIGTIVHMTHFSDADGPRGIDHQLAAFEQAT
QGLPGEASLSNSAATLWHPRAHRDWVRPGVILYGASPTGVAADIEGTGLMPAMTLKSELI
AVQDLQPGATVGYGSRFEAEQPMRIGIVACGYADGYPRHAPGWDGNYTPVLVDGVRTRMV
GRVSMDMITVDLAEVPGARVGAPVTLWGQGLPIDEVAHAAGTVGYELMCALAPRVPVTVE
PAGAADAGETLGKAA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgccaagacccattcaggccgtcatccacggccccgcactcgccaacaatctccaggtg
gttcgccgccacgccgcggactcgcgcgtctgggcggtcatcaaggccaacgcatacggc
cacggcatcgagcgtgcctatgaggggctgcgccaggccgacggcttcggcctgctcgat
ctggacgaggccgtccggctgcgccagctgggctggcaggggccgatcctgctgctcgag
ggcttcttcaagccggaagacctggcgctggtcgagcaataccgactgaccaccaccgtc
cattgcgaggagcagttgcgcatgctggaactggcgcgcctgaaggggccggtgagtatc
cagctgaagatcaacacgggcatgagccgcctgggcttcgcgccggccgcgtaccgtgcg
gcctgggagcatgcccgcgccatttccggcatcggcaccatcgtccacatgacgcatttt
tccgatgccgacggcccgcgcggcatcgatcaccagttggccgccttcgagcaggccacg
caggggctgccgggcgaggcgagcctgtccaactccgccgccacgctgtggcatccgagg
gcgcaccgggactgggtgcgccccggcgtgatcctgtacggtgcttcgccgaccggcgtg
gccgccgacatcgaaggcaccggcctgatgccggccatgacgctcaagagcgagctgatc
gccgtccaggacctgcagccgggcgcgaccgtcggctacggctcgcgcttcgaggccgag
cagccgatgcgcatcggcatcgtcgcgtgcggctatgccgatggctatccgcgccatgcc
cccggctgggacggcaactacacgccggtgctggtggacggcgtgcgcacgcgcatggtg
ggccgcgtgtcgatggacatgatcaccgtggacctggccgaagtgccgggcgcccgcgtt
ggcgcacccgtcacgctgtgggggcagggcctgccgatcgacgaggtggcgcatgccgcc
ggcacggtcggctacgagctgatgtgcgcgctggcgccgcgcgtgccggtgacggtcgag
ccggccggcgcggcggatgccggcgagacgctcggcaaggcggcctga

DBGET integrated database retrieval system