KEGG   Ralstonia solanacearum FQY_4: F504_2328Help
Entry
F504_2328         CDS       T02751                                 

Definition
(GenBank) Superoxide dismutase [Cu-Zn] precursor
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
rse  Ralstonia solanacearum FQY_4
Brite
Enzymes [BR:rse01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     F504_2328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AGH84841
UniProt: M4UGU6
LinkDB All DBs
Position
complement(2512865..2513413)
Genome map
AA seq 182 aa AA seqDB search
MKQLVIGLAAIGLMAGCASNAGTGASTGAPAAGTSALATLAPKSGSNVQGTIKLLQQGDN
RVAMAVDIAGLPPNGMFGFHVHEKGDCSSPDGMSAGGHFNPTGQPHGDPRSGPHHAGDIP
MLQSDASGKAVGSIVLTGVTLTPGATSLVGRAVIVHAGMDDYKTQPTGNSGGRVACGVIV
AN
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactcgtgatcggacttgccgcgatcggcctgatggccggctgcgcttcgaat
gccggcaccggcgccagcaccggcgcacccgccgccggcacctcggctttggccacgctg
gcgcccaagagcggcagcaacgtgcaaggcaccatcaagctgctgcagcaaggcgacaac
cgggttgcgatggcggtcgacattgccggcctgccgcccaacggcatgttcggcttccat
gtgcacgagaagggcgactgctcctcgccggacggcatgagcgcgggcggccacttcaac
ccgaccggccagccgcacggcgatccgcgctccggcccgcaccatgccggcgacatcccg
atgctgcagtccgatgccagcggcaaggccgtcggctcgatcgtcctgaccggcgtcacg
ctcacgcccggcgccaccagcctggtcggccgcgcggtgatcgtccatgcgggcatggac
gactacaagacccagccgaccggcaactccggcgggcgcgtcgcttgcggcgtgatcgtg
gcgaactga

DBGET integrated database retrieval system