KEGG   Ralstonia solanacearum FQY_4: F504_2472Help
Entry
F504_2472         CDS       T02751                                 

Definition
(GenBank) Superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rse  Ralstonia solanacearum FQY_4
Brite
Enzymes [BR:rse01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     F504_2472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AGH84985
UniProt: M4UWR7
LinkDB All DBs
Position
complement(2657336..2657914)
Genome map
AA seq 192 aa AA seqDB search
MAHTLPPLPYALDALAPHISKETLEFHYGKHHQTYVTNLNNLIPGTEFENLSLEDIVKKS
SGGLFNNAAQVWNHTFYWNGLKPNGGGAPAGALADAINAKWGSFDKFKEEFTKVAIGTFG
SGWAWLVKKADGSLDLVSTSNAATPLTTDAKPLLTCDVWEHAYYIDYRNARPKYVEAFWS
LVNWDFVASNFA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcccacacgctccccccgctgccgtacgcactcgacgccctggcgccgcacatctcc
aaggaaaccctggagttccactacggcaagcaccaccagacctacgtcacgaacctgaac
aacctgatcccggggaccgagttcgagaacctgagcctggaagacatcgtcaagaagtcc
tcgggcggcctcttcaacaacgccgcgcaggtgtggaaccacacgttctactggaacggc
ctgaagcccaacggcggcggtgctccggccggcgcgctggctgacgccatcaacgccaag
tggggcagcttcgacaagttcaaggaagagttcaccaaggtcgccattggcaccttcggc
tcgggctgggcctggctggtgaagaaggcggacggctcgctggacctggtgtccacctcc
aatgccgccacgccgctgacgacggacgccaagccgctgctgacctgcgacgtgtgggaa
cacgcctactacatcgactatcgcaacgcccgtccgaagtacgtcgaggcgttctggagc
ctggtcaactgggatttcgtcgcgagcaacttcgcctga

DBGET integrated database retrieval system