KEGG   Ralstonia solanacearum FQY_4: F504_2735Help
Entry
F504_2735         CDS       T02751                                 

Gene name
pilS
Definition
(GenBank) Two-component sensor PilS
  KO
K02668  two-component system, NtrC family, sensor histidine kinase PilS [EC:2.7.13.3]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
rse02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rse00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    F504_2735 (pilS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rse01001]
    F504_2735 (pilS)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:rse02022]
    F504_2735 (pilS)
   02035 Bacterial motility proteins [BR:rse02035]
    F504_2735 (pilS)
Enzymes [BR:rse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     F504_2735 (pilS)
Protein kinases [BR:rse01001]
 Histidine kinases
  NtrC family
   F504_2735 (pilS)
Two-component system [BR:rse02022]
 NtrC family
  PilS-PilR (type 4 fimbriae synthesis)
   F504_2735 (pilS)
Bacterial motility proteins [BR:rse02035]
 Pilus system
  Twitching motility proteins
   F504_2735 (pilS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisKA PAS_8 HATPase_c PAS PAS_4 PAS_9 HATPase_c_5 PAS_7 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: AGH85247
UniProt: M4UJ84
LinkDB All DBs
Position
complement(2921216..2923264)
Genome map
AA seq 682 aa AA seqDB search
MMRDASKAGGADAAGAGASGMRLWSRLNAWRALRAVWLEPDPPEFQWRLLRYFAFSRAAV
ALVLLLFVSIPREHASDLPAPVGDAMLSLTLPYLALALLILAAAGWWRSRFQFRVRLDVL
LDLLFLGLAYATLSHLSASVAMVFLMPVLAAGALTSLLYALFTAAVASMVVLAAPFLRML
GDGGIDSGLASAGLYGLVYMMAALMMYGLSHRQVAQERLTLARERELRLQQLVNRLMVYD
MQDGVMLVRADGRVVAANPAAAMLLGVPQNAFVGSGTMLFDLKDIPHLHPLLETLRQWLR
RRNRQPGSGADVAGDDEATRILDLQPIAAGGRAALRARLRLRFILPSLANLGRVYMDSLV
SSIGLGLPGEAAGEPPRARGSTAETVAPGWSADDEVFLRHELHDTVLVHVESWERVTEQA
QQEKLASMGRLVASVAHQIRNPLAAISQAAELLDDPGEGGEPVRPEGRGVETRLLRIIRD
NVRRLDQVVADVLMLSRRPRGERVREQLAQVLPEVVERWRAEALRRAGEATEISADLVRV
AVDLARPVLFDPAHLQQVVGNLLDNALRYCRGVPGSILLAAYPLDDTHAELVIWNDGPEV
SAEQQRSLFEPFFTNDAQGTGLGLYMARELCGANDAQIRYGDIALESLLDRTGVMTMEVR
EGLPRRAFVITLMFDPPAVPAE
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgcgacgcttccaaggcgggcggtgccgacgctgcgggtgccggggcgtccggc
atgcgcctgtggtcgcgcctgaacgcctggcgtgcgctgcgcgcggtgtggctggagccc
gatccgcccgaattccagtggcgcctgctgcgctacttcgccttcagccgggcggcggtg
gcgctggtgctgctgctgttcgtctcgatcccccgcgagcatgcgagcgatctgccggca
cccgtcggcgacgccatgctcagcttgacgctgccgtacctggcgctggcgctgctgatc
ctggcggcggcggggtggtggcgctcgcgtttccagttccgggtgcggctggacgtgctg
ctggacctgctcttcctcggattggcctatgcgacgctgtcgcacctgtcggccagtgtg
gcgatggtgttcctgatgccggtgctggcggccggcgcgctgaccagcctgttgtatgcc
ctgttcactgcggcagtggcatcgatggtggtgctggctgcgcccttcctgcgcatgctg
ggcgatggcgggatcgactcggggctggcctccgccgggctgtacggcctggtctacatg
atggccgcgctgatgatgtacgggctgtcgcaccggcaggtggcgcaggagcgcctgacg
ctggcccgcgagcgcgagctgcgcctgcagcagctggtgaaccggctgatggtctatgac
atgcaggacggcgtgatgctggtgcgcgccgacggccgcgtggtggccgccaatcccgcc
gcggcgatgctgctgggcgtgccgcagaatgcattcgtcggcagcgggaccatgctgttc
gacctgaaggacatcccgcacctgcatccgctgctggaaacgctgcgccagtggctgcgc
cgccggaaccggcagccgggcagcggcgccgacgtggccggcgatgacgaggccacgcgc
atcctcgacctgcagccgatcgccgcgggcggccgtgccgcgctgcgtgcccgtctgcgc
ctgcgcttcatcctgccgagcctggcgaacctgggccgcgtctatatggatagcctggtc
agctcgatcggtctgggcctgcccggcgaggccgccggcgagccgccgcgtgcgcgcggc
tccacggccgagaccgtcgcaccgggctggtccgccgatgacgaagtcttcctgcgccac
gaactgcacgacaccgtgctggtgcacgtggagagctgggagcgcgtgaccgagcaggcc
cagcaggaaaagctggcatcgatggggcggctggtggccagcgtggcgcaccagatccgc
aacccgctcgcggccatcagccaggcggccgaactgctggacgacccgggcgagggcggc
gagccggtgcgccccgaggggcgcggcgtggagacgcgcctgctgcgcatcatccgcgat
aacgtgcgccgtctcgaccaggtggtcgccgatgtcctgatgctgtcgcgccggccgcgc
ggcgagcgcgtgcgcgagcagctcgcgcaggtgctgcccgaggtggtggagcgctggcgt
gccgaggcgctgcgccgcgcgggcgaggccaccgaaatcagcgccgacctggtgcgcgtg
gcggtcgacctggcgcggccggtgctgttcgatccggcccacctgcagcaggtggtgggc
aacctgctcgacaacgcgctgcgctattgccgcggcgtgccgggctcgatcctgctggcg
gcctatccgctggatgacacccacgccgaactggtgatctggaacgacggccccgaggtg
tccgccgagcagcagcgtagcctgttcgagccgttcttcaccaatgacgcgcagggcacc
gggctcggtctctacatggcccgcgagttgtgcggtgccaacgatgcgcagatccgctac
ggcgacatcgcgctcgaatccttgctcgatcgcaccggagtgatgaccatggaggtgcgc
gagggcctgccgcgccgcgctttcgtcatcaccctgatgttcgacccacccgctgtgccg
gcggaatga

DBGET integrated database retrieval system