KEGG   Ralstonia solanacearum FQY_4: F504_3688Help
Entry
F504_3688         CDS       T02751                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rse  Ralstonia solanacearum FQY_4
Brite
KEGG Orthology (KO) [BR:rse00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    F504_3688
Enzymes [BR:rse01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     F504_3688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 Glutaredoxin HI0933_like FAD_oxidored Thi4 FAD_binding_3 AlaDh_PNT_C DAO NAD_binding_8 K_oxygenase FAD_binding_2 FMO-like
Motif
Other DBs
NCBI-ProteinID: AGH86200
UniProt: M4V0D8
LinkDB All DBs
Position
megaplasmid:266442..268016
Genome map
AA seq 524 aa AA seqDB search
MLDADVKAQLKAYLERLVQPIELVASIDDSEGSRDMMDLLRDVAAQSGMIALTEQRDDAE
RKPSFLIRRTGTDVGVRFAAIPTGHEFTSLVLALLQVGGYAPKLDDDVIEQIRNIEGDFR
FETYMSLTCQNCPDVVQALNVMSVINPRIQHVAIDGALFQDEVEARKIMAVPTLFLNGEV
FGQGRMGVEEILAKIDTGAAARDAEKLNARAPYDVLIVGGGPAGAAAAVYAARKGVRTGV
VAERFGGQVLDTMSIENFISVPETEGPKFAAALEQHVRQYNVDIMNVQRAVKLTPADEPG
GLAEVTLANGAVLKGRSIIVSTGARWRNVNVPGEQEYRNRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVSHVTLLEFGDQLKADAVLVRKLESLPNATILTNAQTTEITGN
GEKVNGLRYRHRTNGAEHDVALEGVFVQIGLVPNTEWLDGVVERNRFGEIIVDARGHTSV
PGVFAAGDSTTVPFKQIIIATGEGAKAALSAFDHLIRVPLAEAA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgctgatgtcaaggcccaactgaaagcctacctcgaacgccttgtgcagccc
atcgaactggttgcctcgatcgatgacagcgaaggctcccgcgacatgatggacctgctg
cgtgatgtcgccgcgcagtccggcatgatcgcgctcaccgaacagcgcgacgacgccgag
cgcaagccgtcgttcctgatccgccgcaccggcaccgatgtcggtgtccgtttcgcggcc
atcccgaccggccacgagttcacctcgctcgtgctcgcgctgctgcaggtgggcggctac
gcccccaagctcgatgacgatgtcatcgaacagattcgcaacatcgaaggcgatttccgc
ttcgagacctatatgtccctgacgtgccagaactgcccggacgtggtccaggcgctgaac
gtcatgtcggtgatcaacccgcgcatccagcacgtcgccatcgacggcgcgctgttccag
gacgaagtggaagcgcgcaagatcatggccgtgccgaccctcttcctgaacggggaagtc
ttcggtcagggccgcatgggcgtggaagagatcctcgccaagatcgacaccggcgccgcc
gcccgcgacgccgagaagctcaacgcccgcgcaccgtacgacgtgctgatcgtcggcggc
gggccggccggcgcggcggcggccgtgtatgccgcgcgcaagggcgtgcgcaccggcgtg
gtggccgagcgcttcggcggccaggtgctcgacacgatgagcatcgagaacttcatctcc
gtgccggagaccgaagggccgaagttcgccgccgcgctggagcagcacgtgcgccagtac
aacgtcgacatcatgaacgtgcagcgcgccgtcaagctcacgccggccgacgagccgggc
ggcctcgccgaggtgacgctggccaacggcgcggtgctcaagggccgctcgatcatcgtg
tcgaccggcgcgcgctggcgcaacgtcaacgtgccgggcgagcaggaataccgcaaccgc
ggcgtggcgtactgcccgcactgcgatggtccgctgttcaagggcaagcgcgtggccgtg
atcggcggcggcaactccggcgtggaagccgcgatcgacctggcgggcatcgtcagccat
gtcacgctgctcgagttcggcgaccagctcaaggccgatgccgtgctggtgcgcaagctg
gaaagcctgcccaacgcgaccatcctcaccaacgcccagaccaccgagatcaccggtaac
ggcgaaaaggtcaacggcctgcgctacaggcaccgcaccaacggcgccgagcacgacgtc
gcgctggaaggcgtgttcgtgcagatcggcctggtgcccaacaccgagtggctcgacggc
gtggtggagcgcaaccgcttcggcgagatcatcgtcgatgcgcgtggccacaccagcgtg
ccgggcgtgttcgcggcgggcgattcgaccacggtgccgttcaagcagatcatcatcgcc
acgggcgagggtgccaaggccgcattgtccgccttcgatcacctgatccgggtgccgctg
gccgaagccgcctga

DBGET integrated database retrieval system