KEGG   Ralstonia solanacearum FQY_4: F504_621Help
Entry
F504_621          CDS       T02751                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
rse00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rse00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    F504_621
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rse02000]
    F504_621
Enzymes [BR:rse01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     F504_621
Transporters [BR:rse02000]
 Other Transporters
  Pores ion channels [TC:1]
   F504_621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_2 GST_C GST_N GST_N_3 GST_C_3 GST_N_2
Motif
Other DBs
NCBI-ProteinID: AGH83143
UniProt: M4U9S0
LinkDB All DBs
Position
complement(636262..636825)
Genome map
AA seq 187 aa AA seqDB search
MNADDTLHPLNLKTNAQRAPAYLEINPMGKVPALRHGDVLITEQAAVYMYAAELYAEAGL
SPAVGDPLRGSYLRWMVFYGSCFEPALVDRSMQRPPAPPARSPYGDFDAVNSLINAQLSD
SPYLLGERFTAADVLWGSALHWTVGFGLVPETPVLRAYIDRILARPAIQRSRALDEALAA
ELSAVAT
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgcggatgacacgctccacccgctcaacctcaagacgaatgcacagcgcgcgccc
gcctatctcgagatcaatccgatgggcaaggtcccggcactgcgacatggcgatgtactg
atcaccgagcaggcggccgtctacatgtacgcggcggagctgtatgcggaggccggcctg
tcgccggcggtgggcgacccgctgcgcgggtcatacctgcggtggatggtgttctacggc
tcgtgcttcgagcccgcgctggtggaccgctcgatgcagcgtccgccggcaccgccggcg
aggtcgccctatggcgatttcgatgcggtcaacagcctgatcaatgcacagctctcagac
agcccctacctgctgggcgagcgcttcaccgccgccgatgtgctgtggggctctgcgctg
cattggacggtggggttcgggctggtgccggaaacgcccgtgctccgggcctacatcgac
cgcatcctggcgcggccggccatccagcgctcccgtgcgttggacgaggcactggcggcc
gaactgagcgcggtcgccacctga

DBGET integrated database retrieval system