KEGG   Ralstonia solanacearum FQY_4: F504_64Help
Entry
F504_64           CDS       T02751                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit A, Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
rse  Ralstonia solanacearum FQY_4
Pathway
rse00970  Aminoacyl-tRNA biosynthesis
rse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rse00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    F504_64
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rse03029]
    F504_64
Enzymes [BR:rse01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     F504_64
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     F504_64
Mitochondrial biogenesis [BR:rse03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    F504_64
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase Unstab_antitox
Motif
Other DBs
NCBI-ProteinID: AGH82586
UniProt: M4UAC0
LinkDB All DBs
Position
complement(66192..67679)
Genome map
AA seq 495 aa AA seqDB search
MTASTLKTLSAQLAAKEVSAVELARHYLARIEARADLNAFIHVDPEATLAQAQAADARLA
AGDAGPLAGIPIAHKDVFVTRGWRATAGSKMLDSYVSPFDATVVERLAAAGMVTLGKTNM
DEFAMGSSNENSHFGPVKNPWDVARVPGGSSGGSAAAVAADLAPAATGTDTGGSIRQPAS
FSGITGIKPTYGRVSRYGMIAFASSLDQGGPMARTAEDCALLLSAMAGFDARDSTSLEPG
RGGDAEDFGRLLGRPLEGADAARPLAGLRIGLPQEYFGAGLADDVRTAVRAALAELETLG
ATLVDISLPKTELSIPTYYVIAPAEASSNLSRFDGVRYGHRAAEYRDLADMYRKTRAEGF
GWEVKRRILVGTYVLSHGYYDAYYLQAQKIRRIIAQDFQNAFGQCDVIMGPVAPTVAWKL
GEKTDDPLQMYLADIFTLSTSLAGLPGMSVPAGFGANGLPVGLQIIGNYFEEARMLQIAH
AFQQATDWHTRRPAA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatccacgctcaaaaccctgtccgcccaactcgccgccaaggaagtgtcggcg
gtggaactggcgcgccactatctggcgcgcatcgaggcgcgggccgacctgaacgccttc
atccatgtcgaccccgaggccacgctggcgcaggcgcaagccgccgacgcgcgcctggcc
gccggcgacgcggggccgctcgccggtatcccgatcgcgcacaaggacgtgttcgtcacg
cgcggctggcgcgccacggctggctcgaagatgctcgacagctacgtgagcccgttcgac
gccaccgtggtcgagcgcctggccgccgccggcatggtgacgctgggcaagaccaacatg
gacgagttcgcgatgggctcgtccaacgagaactcgcatttcggcccggtcaagaatccg
tgggatgtcgcgcgcgtgccgggcggctcgtccggcggctcggccgcagccgtggcggcg
gacctggcgccggccgcgaccggcaccgacaccggcggctcgatccgccagccggcgtcg
ttctcgggcatcaccggcatcaagccgacgtatggccgggtgtcgcgctacggcatgatc
gcctttgcctcgtcgctggaccagggcggcccgatggcgcgcacggccgaggactgcgcg
ctgctgctgtcggccatggccggcttcgacgcgcgcgattccaccagcctcgagccgggc
cgcggcggcgacgcggaagacttcggccgcctgctgggccggccgctggaaggcgccgac
gccgcccgcccgctggccggcctgcgcatcgggctgccgcaggaatacttcggcgcgggg
ctggccgacgacgtgcgcaccgccgtgcgggccgcgctggcagagctggaaacgctgggc
gccacgctggtcgacatcagcctgcccaagaccgaactgtcgatcccgacctactacgtg
atcgccccggccgaggcctcgtccaacctgtcgcgcttcgacggcgtgcgctacggccac
cgcgcggcggagtaccgcgacctggccgacatgtaccgcaagacccgcgccgaaggcttc
ggctgggaggtcaagcgccgcatcctggtcggcacctatgtgctgtcgcacggctactac
gacgcctactacctgcaggcgcagaagatccgccgcatcatcgcgcaggatttccagaac
gcgttcgggcaatgcgatgtgatcatggggccggtggcgccgacggtggcctggaagctc
ggcgagaagaccgacgatccgctgcagatgtacctggccgacatcttcacgctatcgacc
agcctggccggcctgccgggcatgagcgtgccggccggcttcggcgcaaacggtctcccg
gttggcttgcagatcattggcaactattttgaagaggcacgcatgctgcagatcgcgcat
gcgttccagcaggcgaccgactggcacacgcgccggccggcggcctga

DBGET integrated database retrieval system