KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_0081Help
Entry
Rsph17029_0081    CDS       T00484                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K16953  dimethylpropiothetin dethiomethylase [EC:4.4.1.3]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh00920  Sulfur metabolism
rsh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsh00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Rsph17029_0081
Enzymes [BR:rsh01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.3  dimethylpropiothetin dethiomethylase
     Rsph17029_0081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DMSP_lyase Cupin_7
Motif
Other DBs
NCBI-ProteinID: ABN75201
UniProt: A3PFT5
LinkDB All DBs
Position
1:complement(93400..94098)
Genome map
AA seq 232 aa AA seqDB search
MHSLSERVEQLRLNDCPDWLYLLHEFDALYRQGSDGGSRPIRTHRKRVRDSLALIVEANP
AVNDRPPEVKPVTAHLGRALDLGERGAVQGMSRALARVAGRLTWEYGYEKVPKALARKYA
YCEILGPRGPICAERLILGFVLFAPSTTYPQHSHKDIEESYISVAGAWSENDAAVHAPGS
LILNRPGLEHRITTGDLSPCLLAYAWTGSEERLNQPGMKLSSPRKARIEKGI
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcactccttatccgaacgcgtagaacagctgcgcctgaacgactgccctgactggctt
taccttctccacgagttcgatgcgctctaccgtcagggttcggacggcgggagccgcccg
atccgcactcaccgcaagcgggtgcgggattccttggcgttgatcgttgaagcgaacccc
gcggtcaatgatcgcccccccgaggtgaagccggtcacggcccacctcggccgcgcgctc
gatctcggagaaaggggtgccgtccagggcatgtcgagggcgctggcccgtgtcgcaggc
aggctcacctgggaatacggctacgagaaggttccgaaggcactcgcgcgcaaatatgcc
tattgcgaaatcctcggtccgcgaggcccgatctgtgccgagagactgatcctgggcttc
gtgctctttgcgccgagcacgacctatccgcagcacagccacaaggacatcgaggagagt
tacatctcggtcgcgggggcctggtccgagaacgacgccgcggttcatgcgcccgggtcc
ctgatcttgaaccggccgggcctcgaacaccggatcacgacgggtgacctgtcgccctgc
ctgctggcctatgcctggacgggttcggaagaacggctgaaccagccgggaatgaaactc
agttcgccgcggaaggcacgaatcgagaaagggatatga

DBGET integrated database retrieval system