KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_0696Help
Entry
Rsph17029_0696    CDS       T00484                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh00970  Aminoacyl-tRNA biosynthesis
rsh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Rsph17029_0696
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rsh03029]
    Rsph17029_0696
Enzymes [BR:rsh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Rsph17029_0696
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Rsph17029_0696
Mitochondrial biogenesis [BR:rsh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Rsph17029_0696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ABN75809
UniProt: A3PHJ3
LinkDB All DBs
Position
1:complement(702665..704176)
Genome map
AA seq 503 aa AA seqDB search
MLDLTYEAPKPKVIAGAKHDWELVIGMEIHAQVSSNAKLFSGASTTFGAEPNSNVSFVDC
AMPGMLPVINEFCVAQAVRTGLGLKAQINLVSAFDRKNYFYPDLPQGYQISQLYHPIVGE
GEVLVELAPGIARLVRIERIHLEQDAGKSIHDMDPNLSFVDFNRTGVALMEIVSRPDIRG
PEEAAAYVAKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFSHLGTRC
EIKNMNSMRFIQQAIDYEARRQIAILEDGGKVVQETRLYDPDKGETRSMRSKEEAHDYRY
FPDPDLLPLEIEQGWVDEIAASMPELPDAKKARFMADYGVTDYDANVLTAELDAAAYFEE
VARGRDGKQAANWVINELFGRLNKQGLTIADPPVKAGQLGGVLDLIASGEISGKMAKDLF
EILWTEGGDPAEVAAARGMKQVTDTGAIETAVDEIIAANPAQVEKAKANPKLAGWFVGQV
IKATGGKANPAAVNQIVAQKLGL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacctgacctacgaagcccccaagcccaaggtgatcgccggggccaagcacgac
tgggaactggtgatcgggatggagatccacgcccaggtctcgtcgaatgccaagctcttc
tcgggggcctcgaccaccttcggggccgagccgaactcgaacgtgtccttcgtggactgc
gcgatgccgggaatgctgccggtcatcaacgagttctgcgtggcgcaggcggtccgcacc
ggcctcggcctgaaggcgcagatcaacctcgtctcggccttcgaccgcaagaactacttc
tacccggacctgccgcagggctaccagatcagccaactctaccacccgatcgtgggcgag
ggcgaggtgctggtcgagctggccccgggcatcgcgcggctggtgcggatcgagcgcatt
cacctcgagcaggacgcgggcaagtcgatccacgacatggacccgaatctctccttcgtg
gacttcaaccgcaccggcgtcgcgctgatggagatcgtgagccgccccgacatccgcggc
cccgaggaggcggcggcgtatgtggcgaaactccgccagatcctgcgctacctcggcacc
tgcgacggcaacatgcagaacggcaacctccgcgccgacgtgaacgtgtcggtctgccgt
ccgggacagtacgagaagtatcaggagacgcaggatttctcgcatctgggcacccgttgc
gagatcaagaacatgaactcgatgcgcttcattcagcaggccatcgattacgaggcgcgc
cgccagatcgccattctcgaggatggcggcaaggtggtgcaggaaacgcggctctacgat
cccgacaagggcgagacacgctcgatgcggtcgaaggaagaggcgcacgattaccgctac
ttccccgaccccgacctcctgccgctcgagatcgaacagggctgggtggacgagatcgcg
gcctcgatgcccgaactgccggacgcgaagaaggcccgcttcatggccgactatggcgtg
acggactacgacgccaatgtgctgacggccgaactcgatgcggcggcctatttcgaggaa
gtggcccgcgggcgcgacggcaagcaggcggcgaactgggtcatcaacgagctcttcggc
cggctgaacaagcagggcctgaccatcgccgacccgccggtgaaggccggacagctgggc
ggggttctcgatctgatcgcgtcgggcgagatttccggcaagatggccaaggatctgttc
gagatcctctggaccgagggcggcgatccggcagaggtggccgcggcgcgcggcatgaag
caggtgaccgacaccggggccatcgagacggcggtcgacgagatcatcgcggccaatccc
gcgcaggtcgagaaggccaaggcgaaccccaagcttgcgggctggttcgtgggtcaggtc
atcaaggccacgggcggcaaggccaatccggccgccgtcaaccagatcgtggcccagaag
ctggggctctga

DBGET integrated database retrieval system