KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_0787Help
Entry
Rsph17029_0787    CDS       T00484                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh00473  D-Alanine metabolism
rsh00550  Peptidoglycan biosynthesis
rsh01100  Metabolic pathways
rsh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rsh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Rsph17029_0787
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rsph17029_0787
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Rsph17029_0787
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rsh01011]
    Rsph17029_0787
Enzymes [BR:rsh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Rsph17029_0787
Peptidoglycan biosynthesis and degradation proteins [BR:rsh01011]
 Precursor biosynthesis
  Amino acid ligase
   Rsph17029_0787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABN75898
UniProt: A3PHT2
LinkDB All DBs
Position
1:795345..796268
Genome map
AA seq 307 aa AA seqDB search
MAGQSGRTFPRVAVLMGGASTEREVSLSSGHSCSAALRDAGYEVTEVDAGPDLARVLAEL
SPDAVFNALHGRWGEDGCVQGLLEWLRIPYTHSGVLASALAMDKARAKEVFAAAGLPVTQ
SVLATPEEVRARHILPPPYVVKPNAEGSSVGVYIVHEDANGPPQLAADMPQDLMVETYVP
GRELTVTVMGDRVLAVTDILSDGWYDYDAKYRPGGSRHIVPADLPAEITEACHDIALRAH
RALGCRGISRSDLRWDEARGLAGLILLETNTQPGMTPTSLSPEQAAHCGYSFPEFCAWLV
EDASCSR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcgggacagtccggcaggacgttccccagggttgctgtgctgatgggcggggcctcg
accgagcgcgaggtgtcgctgtcgtcgggccattcgtgcagcgcagccctgcgggacgca
ggctatgaggtgacggaggtcgatgccggccccgacctcgcccgcgtgctggcggagctt
tctcccgatgcggtcttcaacgcgcttcacggccgctggggcgaggatggctgcgtgcag
ggcctgctcgagtggctgcgcattccctatacccattccggggtgctggcctcggcgctg
gccatggacaaggcccgcgcgaaggaggtcttcgccgcggccgggctgcccgtgacccaa
agcgtgctcgccacgcccgaggaggtgcgggcgcgccacatcctgccgccgccctatgtg
gtcaagcccaatgccgagggctcttcggtgggcgtctatatcgtgcacgaggatgccaac
ggtccgccgcagctcgcggccgacatgccgcaagacctgatggtcgagacctatgtcccc
ggccgcgaactcaccgtcaccgtgatgggcgaccgggtgcttgcggtcaccgatatcctg
tccgacggctggtacgattacgacgccaaataccgtcccggcggctcgcgtcacatcgtg
cctgcggacctgccggccgagatcaccgaggcctgccacgacatcgcactccgtgcccac
cgcgcgctcggctgccgcggcatctcgcgctcggacctgcgctgggacgaagcgcgcggg
ttggcggggctgatcctccttgagaccaacactcagccgggcatgacccccacctcgctc
tcgcccgagcaggcggcgcattgcggctattccttccccgagttctgcgcctggttggtg
gaggacgcctcatgcagtcgctga

DBGET integrated database retrieval system