KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_0848Help
Entry
Rsph17029_0848    CDS       T00484                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh00250  Alanine, aspartate and glutamate metabolism
rsh00410  beta-Alanine metabolism
rsh00640  Propanoate metabolism
rsh00650  Butanoate metabolism
rsh01100  Metabolic pathways
rsh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Rsph17029_0848
   00650 Butanoate metabolism
    Rsph17029_0848
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rsph17029_0848
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rsph17029_0848
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rsh01007]
    Rsph17029_0848
Enzymes [BR:rsh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Rsph17029_0848
Amino acid related enzymes [BR:rsh01007]
 Aminotransferase (transaminase)
  Class III
   Rsph17029_0848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABN75959
UniProt: A3PHZ3
LinkDB All DBs
Position
1:complement(863233..864510)
Genome map
AA seq 425 aa AA seqDB search
MLNADVSRRRTEAVSRGVGMQTQIYADRALNAEIWDIEGRRYIDFAAGIAVVNTGHCHPK
VMAAVAEQMGRFTHTCHQVLPYENYIRLAERLNAAAPGDFAKKTVFVTTGAESVENAIKI
ARIHTGRSAVVAFGGGFHGRTFMTMSLTGKVEPYKKGFGTMMPEVYHVPFPQALHGISTE
EAMAALARLFKADLDPGRVAAIIFEPVQGEGGFYPAPPDLVRAIRQLCDAHGIVMIADEV
QTGFARTGTLFAMHGYDVAPDLVTMAKGLGGGLPIAAVTGRAEIMDAAHPGGLGGTYGGN
PLGIAAAHAVLDVIEEENLCARATELGSRLKQKLAEIRATAPEIADIRGPGFMVGAEFAD
PGSKAPDAGFTNRVREEALKRGLILLTCGVHGNVIRFLAPITIPEPHFAEALEILEASVA
AARQG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatgccgacgtaagccgccgccgcaccgaagccgtgtcgcgcggcgtggggatg
cagacccagatctatgccgaccgcgcgctcaatgccgagatctgggacatcgaggggcgc
cgctacatcgatttcgcggccggcatcgcggtggtgaacaccggccactgccacccgaag
gtcatggctgcggtcgccgagcagatgggccgcttcacccacacctgccatcaggtgctg
ccctacgagaattacatccgcctcgccgagcggctgaatgccgcggcgccgggcgacttc
gccaagaagacggtcttcgtcaccaccggcgccgaatcggtcgagaatgcgatcaagata
gcccgcatccacaccgggcgctcggccgtcgtggccttcggcggcggcttccacggccgc
accttcatgaccatgtcgctcaccggcaaggtcgagccctacaagaagggcttcggcacg
atgatgcccgaggtctaccacgtccccttcccgcaggcgctgcacggcatctcgaccgag
gaggcgatggccgccctcgcccggctcttcaaggccgacctcgacccgggccgcgtggcc
gcgatcatcttcgagccggtgcagggcgagggcggcttctatcccgcgccgccggatctc
gtgcgggcgatccggcagctctgcgatgcgcacgggatcgtcatgatcgccgacgaggtg
cagacgggcttcgcgcgcaccggcacgctctttgccatgcacggctatgacgtggcgccc
gacctcgtcaccatggccaaggggctgggcgggggcctgcccatcgccgcggtgacgggg
cgggccgagatcatggacgcggcccatccgggcggcctcggcggcacctacggcggcaac
ccgctgggcatcgccgcggcccatgcggtgctcgacgtgatcgaggaggagaacctctgt
gcccgcgcgaccgagctcggcagccggctgaagcagaagctggccgagatccgggccacg
gcgcccgagatcgccgacatccgcggcccgggcttcatggtgggcgcggaatttgccgat
cccggctcgaaggcgcccgacgcgggcttcaccaaccgggtgcgcgaggaggcgctgaag
cgcgggctgatcctgctcacctgcggtgttcatggcaacgtgatccgcttcctcgcgccg
atcaccatccccgagccgcatttcgccgaggcgctggagatcctcgaagcctcggtcgca
gcggcccggcagggctga

DBGET integrated database retrieval system