KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_0940Help
Entry
Rsph17029_0940    CDS       T00484                                 

Definition
(GenBank) RNA-binding S4 domain protein
  KO
K06178  23S rRNA pseudouridine2605 synthase [EC:5.4.99.22]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Brite
KEGG Orthology (KO) [BR:rsh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rsh03009]
    Rsph17029_0940
Enzymes [BR:rsh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.22  23S rRNA pseudouridine2605 synthase
     Rsph17029_0940
Ribosome biogenesis [BR:rsh03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    Rsph17029_0940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S4 PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ABN76051
UniProt: A3PI85
LinkDB All DBs
Position
1:complement(967378..968847)
Genome map
AA seq 489 aa AA seqDB search
MTDSKDGERIAKVLSRAGIASRRDAERMIELGRIAVNGRTIDSPALNVGPKDRITVDGQP
LAPPEPARLWLYYKPEGLVTSASDEKGRETVFDHLPEGMPRVMSVGRLDLNSEGLLLLTN
DGELKRRLELPSTGWLRKYRVRVKGNPTDADLEPLRKGITVEGESFQPMTVSLDRVQGAN
AWLTVGLREGKNREIRRAMSALGLTVNRLIRVSYGPFRLNELEPGMVEEVRPKILRDQLG
LDPHADGEARPARGRKPEGAARAEGAARSERTARPPRGAAAEGPTRPARAAGSEGSAGAT
RGRSPQGAAPKAGAPKDGARFAGKGPAEGARPARSAATDPARASRPASTETTGRTRTAEG
RGKPAAAGRSGKTEAADAPRAFRSRSAEAPAKGPRGPAKAAGPARSRREALPDTPIDARA
PRGRAAAGPKAKGGSPAKAAPTPRAKGAGETAGGRGPRTGGPSAQGDRKPQPTGPRPPSR
GPKGRPGGR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacagcaaagacggcgagcgcatcgccaaggttctctctcgtgcgggcatcgcc
tcgcgccgcgacgccgagcggatgatcgagcttggccgcatcgcggtgaacgggcgcacc
atcgacagcccggcgctgaatgtgggcccgaaggaccgcatcaccgtcgacggccagccc
ctggcgccgcccgagcccgcccgcctgtggctctattacaagcccgagggactcgtcacc
tcggcctcggacgagaagggccgcgagacggtcttcgaccacctgcccgaggggatgccc
cgcgtcatgtcggtgggacggctcgatctcaattccgagggtctcctcctcctgaccaat
gacggcgaactgaagcgccggctcgagctgccctccaccggctggctgcgcaagtaccgc
gtgcgggtgaagggcaacccgaccgacgccgacctcgagccgctgcgcaaggggatcacg
gtcgagggcgagagcttccagccgatgaccgtctcgctcgaccgggtgcagggcgccaac
gcctggctcacggtgggcctccgcgagggcaagaaccgcgagatccgccgcgccatgtcc
gccctgggcctcaccgtgaaccggctgatccgcgtgagctacggtcccttccggctgaac
gagctcgagcccggcatggtcgaggaggtgcgccccaagatcctgcgcgaccagctcggc
ctcgatccgcatgccgacggcgaggcgcgcccggccaggggacggaagcccgaaggtgcc
gcacgagccgaaggcgccgcacgctccgaaagaaccgcgcgtccgccgcgcggggccgcg
gcggagggacccacccgcccggctcgggcagcggggtccgaaggctccgcaggcgccacc
agagggcgctcgccgcagggggctgcgcccaaggcaggggcgcccaaggacggggcacgc
ttcgcaggcaaaggcccggccgagggtgcgcgcccggcgcggagcgccgcaacggacccc
gcgcgcgcctcccgaccagcgagcaccgagaccaccggacgcacccgaacggcggagggc
cgaggcaaacccgccgccgcaggacggtccggcaagaccgaggcggccgacgcgccgcgt
gcgttccgcagccgcagcgccgaggcgcccgccaagggtccgcgcggtccggccaaggcc
gcgggtccggcccgcagccggcgagaagccctgcccgacacgccgatcgacgcccgtgcg
ccgcggggtcgcgccgcggcgggtccgaaggccaagggcggcagtccggccaaggccgcc
cccactccgcgcgccaagggagcgggcgagaccgccggcggacggggcccccggacgggc
gggccgtctgcccagggggaccggaaaccgcagcccacaggcccccgcccgccctcgcgc
ggaccgaaaggccggcccggcgggcgctga

DBGET integrated database retrieval system