KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1076Help
Entry
Rsph17029_1076    CDS       T00484                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh03030  DNA replication
rsh03410  Base excision repair
rsh03420  Nucleotide excision repair
rsh03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:rsh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Rsph17029_1076
   03410 Base excision repair
    Rsph17029_1076
   03420 Nucleotide excision repair
    Rsph17029_1076
   03430 Mismatch repair
    Rsph17029_1076
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rsh03032]
    Rsph17029_1076
   03400 DNA repair and recombination proteins [BR:rsh03400]
    Rsph17029_1076
Enzymes [BR:rsh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Rsph17029_1076
    6.5.1.6  DNA ligase (ATP or NAD+)
     Rsph17029_1076
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Rsph17029_1076
DNA replication proteins [BR:rsh03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Rsph17029_1076
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Rsph17029_1076
DNA repair and recombination proteins [BR:rsh03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Rsph17029_1076
   NER (nucleotide excision repair)
    Other NER factors
     Rsph17029_1076
   MMR (mismatch exicision repair)
    Other MMR factors
     Rsph17029_1076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ABN76187
UniProt: A3PIM1
LinkDB All DBs
Position
1:complement(1110476..1112077)
Genome map
AA seq 533 aa AA seqDB search
MKRFAALFDLLDRTTRTSAKVAALADYFRTAPEEDRVWTIGLLSGRRPKRAVNTTELRSW
AAEASGLPVWLAEEVHPIVGDLAETISLLLPEPSQTSDRTLDGWMRELVSLTGRPAEVRR
AAILDAWDRLSTPERFLFNKLITGGFRMGVSQGLMTRALAQATGVDEAVLAHRLMGDWKP
GRIGFETLIGAHDPEADASKPYPFALASPVEEVAALGDPADWLAEWKWDGIRGQLVNRAG
AFALWSRGEELVTDRFPDLAPLRDFLPPGLVIDAEVLAWGGDGPLPFAALQKRIGRLTVP
KKILAEAPAHLLAYDLLEENGEDLRAAPLAHRRARLEAVLAALPPGVPISPSPLVAFDDW
ETLGGIRATAREKIAEGLMLKRASSPYFVGRKRGDWWKWKLDPYTVDAVMLYAQQGAGRR
ATLFTDFTFGVRDGDDLVPFTKAYSGLTDAEFRQITDWVRKNTLERFGPVRRVPPELVFE
LAFEGIQASPRHKSGIALRFPRMVRWRKDKPAAEIDTLESLRELLAATGGAAP
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggttcgcggccctcttcgacctcctcgaccgcacgacgcgcacctccgcgaag
gtggcggcgctcgccgactatttccgcaccgcgcctgaggaggaccgggtctggaccatc
ggcctcctctcgggccgccgccccaagcgggcggtgaacacgaccgaactccgcagctgg
gcggccgaggcatcgggtctgccggtctggctcgccgaggaggtccatccgatcgtgggc
gatctggccgagacgatctcgctcctcctgcccgagcctagccagaccagcgaccgcacg
ctcgacggctggatgcgcgaactggtttccctcacaggccgacccgccgaggtgcgccgg
gccgccatcctcgacgcctgggaccggctcagcacgcccgagcggttcctcttcaacaag
ctcatcaccggcggtttccgcatgggcgtgagccaggggctgatgacgcgcgcgctggcg
caggcgaccggcgtcgacgaggcggtgctggcgcaccggctgatgggcgactggaagccc
ggccggatcggcttcgagacgctgatcggcgcgcacgatcccgaggccgatgcctcgaaa
ccctatccgttcgcgctcgcctcgccggtcgaggaggtggcggcgctgggagatcccgcc
gactggcttgcggaatggaaatgggatggcatccgcggccagctcgtgaaccgcgcgggc
gccttcgcgctctggtcgcgcggcgaggagctggtgacggaccgtttccccgacctggcc
ccgctccgggatttcctgccccccggcctcgtgatcgatgccgaggtgctggcctggggc
ggcgacggccccctgcccttcgccgcgctccagaagcggatcggccgcctcaccgtgccg
aagaagatcctcgccgaggcgcccgcgcatctgctggcctacgatcttctggaggaaaac
ggcgaggatctgcgcgcggccccgctcgcgcaccgtcgcgcccggctcgaagcggtgctg
gcagccctgcccccgggcgtgccgatctcgccctcgccgctggtggccttcgacgactgg
gagacgctgggcgggatccgcgccacggcgcgcgagaagatcgccgaggggctgatgctg
aagcgcgcctcctcgccctatttcgtcggccgcaagcgcggcgactggtggaaatggaag
ctcgatccctatacggtcgatgcggtcatgctctatgcgcagcagggcgcgggccgccgc
gccacgctcttcaccgacttcaccttcggcgtgcgcgacggcgacgatctcgtgcccttc
accaaggcctattccggcctcaccgatgccgagttccgccagatcaccgactgggtgcgg
aagaacacgctggagcggttcggacccgtccggcgcgtcccgcccgagctggtcttcgag
ctggccttcgagggcattcaggccagcccccgccacaagtcgggcatcgcgctccgcttc
ccgcgcatggtgcgctggcggaaggacaaacccgcagccgagatcgacacgctcgaaagc
ctgcgcgaactgctcgcagcgacgggcggggcggccccatga

DBGET integrated database retrieval system