KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_2556Help
Entry
Rsph17029_2556    CDS       T00484                                 

Definition
(GenBank) Glutathione S-transferase, N-terminal domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Pathway
rsh00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rsh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Rsph17029_2556
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsh02000]
    Rsph17029_2556
Enzymes [BR:rsh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Rsph17029_2556
Transporters [BR:rsh02000]
 Other Transporters
  Pores ion channels [TC:1]
   Rsph17029_2556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C
Motif
Other DBs
NCBI-ProteinID: ABN77658
UniProt: A3PMU2
LinkDB All DBs
Position
1:2695272..2695904
Genome map
AA seq 210 aa AA seqDB search
MTERGMDRLTLYTNPRSRGRIARWMLEEVGQPYDLVTMDYGPEMHTPDYLALNPMGKVPT
VTHGSRVITETAAICAYLADAFPEAGLVPENRASYYRWLFFAAGPFEAAVIDRALGVQIP
PERTVMVGYGDFDRAVATLEHAVSDTPFIAGERFSAADVQVGSQIGWGLQFGTIPDRPAF
RAYWERLADRPARVRAAAMDDALMAGASHG
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgacggagagaggcatggacaggctcacgctctatacgaacccccgctcgcgcggacgc
atcgcgcgctggatgctcgaggaggtcggccagccctacgacctcgtgacgatggattac
ggccccgagatgcatacgcccgactatctggcgctcaatccgatgggcaaggtccccacc
gtcacgcacgggtcgcgggtcatcaccgagacggccgcgatctgcgcctatctcgccgac
gccttccccgaagcagggctcgtgcccgagaaccgggcctcctactaccgctggctcttc
ttcgccgccgggcccttcgaggcggcggtgatcgaccgggcgctcggggtgcagatcccg
ccggagcggaccgtgatggtgggctacggcgacttcgaccgggccgtggccacgctcgag
cacgcggtctcggatacgcccttcatcgccggcgagcggttcagcgcggccgacgtgcag
gtcggttcccagatcggctgggggctccagttcggcacgatccccgaccggccggccttc
cgcgcctattgggagcggctggccgaccgcccggcgcgggtgcgggcggcagccatggac
gatgcgctgatggccggggcctcccatggctga

DBGET integrated database retrieval system