KEGG   Runella slithyformis: Runsl_0903Help
Entry
Runsl_0903        CDS       T01553                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
rsi  Runella slithyformis
Pathway
rsi00240  Pyrimidine metabolism
rsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Runsl_0903
Enzymes [BR:rsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Runsl_0903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AEI47340
UniProt: F8EJU9
LinkDB All DBs
Position
1068715..1069302
Genome map
AA seq 195 aa AA seqDB search
MFIEPNHNSKNSQPRIGWVEVVCGSMFSGKTEELIRRLNRAKIARQKVEIFKPAIDKRYH
DVDIVSHNENSIRSTPVNTSEEILLFAGDCDVVGIDEAQFLDNNLVEVCNKLAGSGKRVI
VAGLDMDFAGKPFGPMPLLLSIAEYVTKVHAVCVVCGEVAQYSYRKVTSQDKILLGETDS
YEARCRRCYTLGELA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgttcatcgaacccaatcataattctaaaaattcacagcctcgcattgggtgggtggag
gttgtctgtgggtccatgttttcgggaaaaaccgaagaactcattcggcggctcaaccgc
gcaaaaatcgcccggcaaaaggtagaaatctttaaacctgccattgataaacgttaccac
gacgtagacattgtttctcataacgaaaattcgatccgttcgacccccgtcaacacctcc
gaagaaatattactctttgccggtgattgcgacgtggtgggcatcgacgaagctcaattt
ttagacaacaatctggtagaggtttgcaacaagcttgccggcagcggaaaacgcgtcatt
gtggcgggcttagacatggattttgccggaaagcctttcggtcccatgccgcttctgtta
tccattgccgagtacgttacgaaagtccacgcagtgtgtgtcgtctgtggagaagtagcg
caatattcataccgaaaagtgacttcacaggataaaattcttttgggcgaaaccgactcc
tacgaggcccgttgccgcagatgttacacgctgggtgaattggcgtga

DBGET integrated database retrieval system