KEGG   Runella slithyformis: Runsl_1765Help
Entry
Runsl_1765        CDS       T01553                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rsi  Runella slithyformis
Pathway
rsi00620  Pyruvate metabolism
rsi00680  Methane metabolism
rsi01100  Metabolic pathways
rsi01120  Microbial metabolism in diverse environments
rsi01200  Carbon metabolism
Module
rsi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Runsl_1765
  09102 Energy metabolism
   00680 Methane metabolism
    Runsl_1765
Enzymes [BR:rsi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Runsl_1765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 PRTase_3
Motif
Other DBs
NCBI-ProteinID: AEI48189
UniProt: F8EDR3
LinkDB All DBs
Position
complement(1992018..1994591)
Genome map
AA seq 857 aa AA seqDB search
MPNVYQDAVVTKYNIFNSLFLSLPFHDIFRTGTLLPLLVQASEEGFEAGNSPQQIIESFF
EEYTEHATEHERRDMLFNFIKFIERQVVLFDSVEDAGFDQTHDLNGPGSITQLLNRVDSD
DLREKLLKKLDDFCVRIVLTAHPTQFYPGKVLGIITDLEEAIKDNDFVTVNNLLLQLGKT
GFINKNKPTPFDEALTLGWFLENVFYEAIPAILKKLLRGLNIPIDQWEHTELFRLGFWPG
GDRDGNPFVTSDVTLQVADRLRQILLKCYWRDIKYLKRRLTFDGVEDFIATAERKINNAI
YYPDQEHYASSPELLHDLQQAREVLVKYHDSFFVDSLDDIILKIKLFGFFFASLDIRQVS
PKHSLAWEEVLTKIEKQVPVFTYADYRDWDEKRKIDFLLSLQVELTEADFHDPITQDIYG
SMLAIREIQRRNGEAGAHRYVISNCASALNVVEVLALMKNVWKTTDIGVDIVPLFETVDD
LAGAADVMKQLFENKYYRAHLERRGNQQTIMVGFSDGTKDGGYLRANWSIFTAKEQLTRI
SREYDVKVTFFDGRGGPPGRGGGNNHAFYASLGKDIEDKEIQLTVQGQTISSNYGTVPTA
MYNLERLFTAGLENHLFMSKNTKDQLSESDKALMEELANVAYEAYLGLKNHKTFVPYLEK
ITPLRFYGQTKIGSRPDKRGSGGGLKFEDLRAIPFVGSWAQMKQNVPGFYGFGSALETLK
KNGKMDALKKLYKRSLFVRTLVENSMQSLMKAYYPATKYLKENPEFSTLWTMMFEEYERS
INLMLEFSGEKELMNQNPVTKESIIVRERIVLPLMTIQQYALQKLQSSDLPAAEVDVYSK
LVMRAMFGIINAARNSA
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacgtttatcaagacgctgttgtaacgaagtacaatatcttcaacagcctgttc
ctgagtctaccgtttcatgacatttttcgtacaggaacactcttaccgctgcttgtgcag
gccagcgaagagggatttgaagccggaaacagtccgcaacaaatcattgagtcttttttt
gaggagtacacggagcatgccaccgagcatgaacgacgcgatatgctctttaacttcatt
aaatttattgaacgtcaggtcgttttgtttgattcggtagaagatgccggctttgatcaa
acccacgacctgaacggtcccggttccattactcaattactgaatcgggtagacagtgat
gatctgcgcgagaagttgttgaaaaaactggatgacttttgcgtcagaatcgttctgacc
gcccacccaacccaattttatccgggaaaagtattgggtattattaccgatctggaagag
gcaatcaaggacaacgatttcgtgacggtcaataatttattgcttcaattgggaaaaaca
gggtttatcaataaaaataagcctacgccctttgacgaagccctgaccttaggctggttt
ttggaaaacgtattttacgaggccattccggccatcctgaaaaagctgcttcgcggactt
aacatccccatcgatcaatgggaacacactgaacttttccgtttgggattttggccgggc
ggtgaccgcgacggtaatccctttgtgacgtcggatgtaaccttgcaggtggctgaccgt
ttacggcagattttgcttaaatgctattggcgggatatcaaatacctgaaacgccgtctg
acgtttgatggagttgaagattttattgccactgctgagcgcaagatcaacaatgccatt
tattatccggatcaggagcattacgcctcttcgcccgaattattgcatgatctgcaacag
gcccgtgaagtattggtcaagtaccacgatagtttttttgtagattcattggatgatata
attctgaaaatcaaacttttcgggtttttctttgccagtttggacattcgccaggtgagt
cccaagcactcgttagcctgggaggaagtcttgaccaaaatagaaaaacaagtccccgtt
tttacctatgccgactaccgggattgggacgaaaaacgcaaaatagactttttgctttcg
ttacaggtagaattgacggaagcagatttccatgatcccattacgcaggatatctacggt
tccatgttggccattcgtgagattcagcgtcgtaatggtgaagcgggagcgcatcgttat
gtgatcagcaactgtgccagtgcgctgaacgtcgtggaagtgctggcattgatgaagaat
gtttggaaaacaacggacatcggtgtggatatagtaccgctttttgaaacggtagatgat
ttggcgggggctgccgatgtaatgaaacaactgtttgaaaataaatactacagggcccac
ttggaacggcgcggaaatcagcaaaccatcatggttggattttcggacggaaccaaagat
ggcggttacctgcgtgccaactggtctatttttacggcaaaagaacagctgaccaggatt
tcgagggaatacgatgtgaaggtaacgtttttcgacggtcgcggaggccctccgggtcgt
gggggtggaaacaaccacgcgttttatgcttcgttgggcaaagacatcgaagacaaagaa
attcaattgaccgtgcagggtcaaaccatcagttccaattacggtacggtccctacggcg
atgtataatttggaaaggctgtttacggcgggtcttgaaaatcaccttttcatgtcaaag
aataccaaagaccaactttccgaatctgataaggcgctgatggaagaactggccaacgtg
gcgtacgaagcgtatctgggcctgaaaaatcacaaaacatttgtaccttatttggagaaa
attactccgcttcgtttttacggacaaaccaagatcggtagtcgtcccgataaacgaggc
agtggcggcggactcaaatttgaggatttgagggctattccgtttgtgggttcctgggcg
cagatgaagcaaaacgtgccgggcttttacggcttcggttctgcactcgaaacattgaag
aaaaatggaaaaatggacgctttgaagaagttatacaagcgttcgctgtttgtacgtacg
ttggtggaaaactccatgcaatcgctgatgaaagcgtattatccggctacaaaatacctc
aaggaaaatcccgaattcagtacgctttggacgatgatgtttgaagagtacgagcgaagc
atcaatcttatgctggagttttcgggcgaaaaagaattgatgaaccaaaatcccgtaacc
aaagaatccatcattgtacgggaacggatcgttttaccgctcatgacaattcaacagtac
gcgcttcaaaagcttcaatcgtcagacctgcctgctgctgaagttgatgtgtacagtaaa
ttggtcatgcgggcgatgtttggaatcatcaatgctgcgcggaactcggcgtaa

DBGET integrated database retrieval system