KEGG   Runella slithyformis: Runsl_4116Help
Entry
Runsl_4116        CDS       T01553                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
rsi  Runella slithyformis
Pathway
rsi00473  D-Alanine metabolism
rsi01100  Metabolic pathways
rsi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Runsl_4116
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Runsl_4116
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rsi01011]
    Runsl_4116
Enzymes [BR:rsi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Runsl_4116
Peptidoglycan biosynthesis and degradation proteins [BR:rsi01011]
 Precursor biosynthesis
  Racemase
   Runsl_4116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C DLIC
Motif
Other DBs
NCBI-ProteinID: AEI50463
UniProt: F8EKI0
LinkDB All DBs
Position
complement(4745274..4747772)
Genome map
AA seq 832 aa AA seqDB search
MTATIFQTSPIATDAVYLLTDSRQLIFPQQTLFFAIKGVRHDGHQFITDLYQKGVRQFVV
EQNSLTDSLLTTLESFENTQIWTVESSLKALQDVAKQHRAQFDIPVIGVTGSNGKTIIKE
WLGQLLSADYRIAKSPKSYNSQIGVPLSVWQLNDTHTLGIFEAGISQLHEMKSLQEIIQP
SIGIFTNIGSAHDEGFRSRKQKVTEKLRLFTQCKQLIYRADYSDIDEEIRLILKSVNPKC
ELISWGSAENALVKAEWHQDTDQTYIVLNSVLEHYDNQLFAIPFTDEASVENCIHCLILM
LTLGIPSTEIRQRVARLRPISMRLELKEGINNCYLIDDTYNNDLVGLTIALNFLSQQEQR
PHKMAILSDLLQTGQKEEELYTQINTLLQQKGVQQLIAIGAAFVRNAHWIQVEASYFADT
DDFLTKFPLQSFNNSLVLIKGARPFQFERIVHRLQQKVHGTVLEINLDALTHNLNFYRSR
VGNDTKIMVMVKAFAYGNGSAEVAQLLQFHRVDYLAVAYTDEGVLLRQNGIELPIMVMNP
TASTFDKLIEYKLEPEIYSHKILDEWLNFQPTLPLSDEEIDAVYPQVPIHLKLDTGMHRL
GFTQADLPLLLYQLQQNPSLKVASVFSHLAGADEAVHNEFTRQQFELFSSGAELLEQTLG
YRPLRHLLNSAGIVRFPEYKLDMVRLGIGLYGVEVNRLEQRSLQQIGTFKTVVSQVKHLL
PGDTIGYGRMGVLEKESFIATIALGYADGYDRRFSKGIGKVLINGALCPVVGNVCMDMTM
VDATGVNVQEGDEVIIFGNDLPISQLADQIGTIPYELLTGISERVKRVFYKE
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaaccatttttcaaacctcgccgattgctaccgatgcagtgtatttgctgacc
gacagccggcaattgattttcccccaacagaccctattctttgccattaagggcgtaagg
cacgacggtcatcagtttattacagatctttatcaaaaaggcgttcgacaatttgtagtg
gagcaaaactcgttgacagattcactgctgaccactcttgaatcgtttgaaaatacccaa
atttggaccgtagaaagtagccttaaagccctacaggatgttgccaagcagcaccgggcc
caatttgacataccggtcatcggcgttacgggcagtaatggcaaaactatcatcaaagag
tggctgggccaattactcagcgctgactatagaattgcaaaaagtcccaaaagttataat
tcacagatcggtgtgccgctatcggtgtggcagctgaatgatacgcatactttggggatt
tttgaggcggggatttcacaactccacgaaatgaaatccctacaggaaatcattcagcca
tccatcggtatctttaccaacatcggctccgcgcacgatgagggctttagaagccgtaag
cagaaagtaaccgaaaagttgcgtcttttcactcagtgtaaacaacttatctaccgcgct
gattactctgatattgacgaagaaattcgtctgatcttaaaatccgttaatcccaaatgt
gaactcatcagttggggctccgctgaaaacgcgttggtaaaggccgagtggcaccaagac
accgaccaaacttacatagtgttgaactcggtcttggagcattatgataatcaacttttt
gccataccatttacggatgaagcttctgtagaaaactgcattcattgcctgattttgatg
ctcacacttggcattccatcgacagagatccggcagcgggtagcacgcctgcggccgatc
tccatgcgacttgagctgaaagaaggcatcaacaattgctatttgattgatgatacgtat
aacaatgacttagtggggctaacgattgcgctcaattttttaagccagcaggaacaacgg
ccacataaaatggctattttatccgatctgctgcaaacggggcaaaaagaagaagaactt
tacacccaaatcaacacgctgcttcaacaaaagggcgttcagcaactgattgccatcggc
gcagcgtttgtgcgaaacgctcattggattcaggtagaagcaagctattttgccgatacc
gacgattttttgaccaagtttcctcttcagtccttcaataacagcttggtgctgatcaaa
ggtgcccgtccgtttcaatttgaacgtatcgtgcatcgcctgcaacagaaggtccacggg
acggtattggaaatcaacctggacgcgcttacgcacaatctcaatttttaccgtagccgg
gtggggaatgacaccaaaatcatggtcatggtcaaggcctttgcctatgggaacgggagc
gcagaagtggcccaactattacagtttcatcgagtggattatttggccgtagcctacacc
gacgaaggcgtgcttttacgtcaaaacgggattgaattacctattatggtaatgaatcct
acagcatctacctttgacaaactgattgaatataaattggagccggaaatctacagccat
aagattttggatgaatggctaaatttccaacccacccttcctctttccgatgaagaaatt
gacgctgtctacccgcaagtgcccattcacctcaagctcgataccggtatgcaccgattg
ggattcacccaagctgatctgcccttgttactttaccaattacagcaaaatccatcgctg
aaagttgcctctgttttcagtcatttggcaggtgcagatgaagcggtccacaatgagttt
acgcggcaacaatttgagctttttagttcgggggctgaactgcttgaacaaacgcttggg
tatcgaccgttgcgccacctgctcaattcggccggaatcgtacgttttccggaatataaa
ctggacatggttcggctgggaatcggcctttacggagtagaggtcaatcggctggaacaa
cgctcattgcagcaaataggcacttttaaaacagtggtgtctcaggtaaaacaccttctt
ccgggcgataccatcggatacggtcgcatgggtgtacttgaaaaagaatcttttatcgca
accattgcgctaggctacgccgatggctacgaccgacgtttcagcaaaggaataggaaaa
gtgcttatcaacggggcattatgtccggtggtaggaaatgtatgcatggatatgaccatg
gttgatgcgacgggtgtaaacgtacaggagggcgatgaagtaattatttttggaaatgat
ctgccaatctcacaattggcagatcaaatcggcaccattccttacgagcttctgaccgga
atcagtgagcgggtcaaacgcgttttttataaagaataa

DBGET integrated database retrieval system