KEGG   Runella slithyformis: Runsl_4779Help
Entry
Runsl_4779        CDS       T01553                                 

Definition
(GenBank) L-iditol 2-dehydrogenase
Organism
rsi  Runella slithyformis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C HI0933_like Pyr_redox_2 Pyr_redox_3 GIDA FAD_binding_2 ADH_zinc_N_2 DAO Pyr_redox UDPG_MGDP_dh_N AdoHcyase_NAD NAD_binding_8 ADH_N_2 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AEI51094
UniProt: F8EQ84
LinkDB All DBs
Position
5524545..5525558
Genome map
AA seq 337 aa AA seqDB search
MNALFYEGNHSFTLKTVETQPLREGEVRLKMAYVGVCGTDVHIYHGKMDARVKPPQIIGH
EVSGIIDALGEGVTGWQIGDKVTVRPLHPGPEVAADNGYRHIGQHLKFIGIDSAGGMQQY
WNVPAFSLHRLPENLSLALGAMIEPLAVACHDVRLGELKAGENAVVIGGGPIGLLIALAA
HQKGANVLISEVNVNRIAFIESLGIQAVNPLEKDIVKSVEEFTHGAMADVVFEVSGVQAG
VSTMTQLPRVRGRIVMVAIHSEPKAVDLFRFFWRELKLIGARVYEPEDFEEAIALAASGT
LPLEKMITQISPLSEAQEIFETIDKNPAGMKYLLEIV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacttttttacgaaggaaatcattccttcactctaaaaacggtcgaaacgcaa
cctctccgggaaggagaagtacgactgaaaatggcgtatgtcggcgtatgcggtaccgac
gtccacatctaccacggaaagatggacgcccgggtcaaaccgccccaaatcatcggacac
gaagtatcgggaatcattgacgcgcttggagaaggcgttaccgggtggcaaatcggagat
aaagtcacggttcgtccgctccatccgggcccggaagtggcggccgacaatggctatcgg
cacatcgggcagcacctcaaatttatcggtatcgactccgccggcgggatgcagcaatac
tggaatgttccggcattttcactgcatcgccttcccgaaaacctttcccttgcccttggc
gcgatgattgaacccttggccgtggcctgtcatgacgtacgactgggcgaactcaaagcg
ggagaaaatgccgtggtcattggcggcggtccgatcggcttgctgattgcgttggcagcc
catcaaaaaggggcaaatgtgctgatttcggaagtgaacgtcaatcgtatcgccttcatt
gaatcgttgggcattcaggcggttaatcccttggaaaaagacattgtcaaatcagtggaa
gaattcacccatggagccatggccgatgtggtctttgaagtctccggcgtacaggcaggg
gtcagcaccatgacgcagcttccgcgtgtgcgcggtcgaatcgtgatggtcgccattcat
tccgagccaaaagccgtggatctgtttcgctttttctggcgcgaattaaagctcatcggt
gcccgcgtctacgagcccgaagactttgaagaagccattgccttagcggcttccggcaca
ttgccgctggaaaaaatgatcacccaaatttccccgttgtctgaggcgcaggaaattttt
gaaaccattgataaaaacccggcggggatgaagtatctgctggagatcgtttaa

DBGET integrated database retrieval system