KEGG   Runella slithyformis: Runsl_5195Help
Entry
Runsl_5195        CDS       T01553                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rsi  Runella slithyformis
Brite
KEGG Orthology (KO) [BR:rsi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rsi01001]
    Runsl_5195
Enzymes [BR:rsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Runsl_5195
Protein kinases [BR:rsi01001]
 Serine/threonine kinases: Other
  Bacterial family
   Runsl_5195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo APH YrbL-PhoP_reg
Motif
Other DBs
NCBI-ProteinID: AEI51495
UniProt: F8EIF2
LinkDB All DBs
Position
complement(6037170..6038681)
Genome map
AA seq 503 aa AA seqDB search
MTAEEFYARFQFDPSMSGSLLGRGGFSSVHKVYDTVRKRYVAVKRSEVGVFQKFDLAREV
TLAHEIDIHPNIIRYENVYRITDRAGVFDYAVMKYYAEGNLDDVLRKHELNDAARRQILT
GILEGLAHLHRVPIIHRDFKTANILMDRAENGDWVPVIADFGLSRLVDADMSYVLNNSQI
AHTPSYAAPEQLLDNVAIRPNTDLWAFGVMTYKMVMGRLPFRVDGAKGEWDTSNRIRSMI
LEGKLPADISTIQEPYKSIIRKCLIFDPEKRVKKAGDLLALLEKRTAASPPPASPEPPRV
ESSYGGKTKIHESPADPPKPSGIHLKEPPIKKAPINVRFPWEMSLLVASLFFVLWIFYWL
ATRSKHPVEDSKNPVASSAESAAPDTILKNSEIKELVKPADLQGSEEKKRPVAEPAKKKI
SSKSYLIIYTTYHNLRVYIDNVPQAEIARTGQKNVYELPIGEGTFFKVEYLVPGRESGLT
TESDRFTVVPGQKYEVRYTEKIF
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctgaagaattttacgctcgttttcaattcgatccatccatgtcgggcagtttg
ctcggacgcggtggtttcagcagcgtgcataaagtgtatgataccgtacgaaaaaggtac
gtagccgttaagaggagtgaagtgggcgtgtttcagaaatttgatttggcgcgggaggta
acgctggcgcacgagattgatattcaccccaatatcattcgctacgaaaacgtctatcga
attaccgatcgcgcaggcgtgttcgattatgccgttatgaaatactatgccgagggcaac
ctggatgatgtgctgagaaagcacgagctgaatgatgccgcacgaagacagatcctgacc
ggtattttagagggcttagctcatctgcaccgagtgccgatcatccaccgggatttcaaa
acggccaatattcttatggacagggccgaaaatggggattgggttcccgtcattgccgat
tttggcctgagccgtttggtcgatgccgacatgagctatgtcctgaataactcacagatc
gcccacacacccagctatgccgctcccgagcagctgctggataatgtggccattcgcccc
aataccgatttgtgggcctttggcgtaatgacctataaaatggtgatgggccgcttaccc
tttcgggtcgacggagccaagggcgagtgggatacttccaacaggatacgaagcatgatc
ctggaaggaaaactgcctgccgatatcagtactattcaggagccctacaaaagtattatc
cgaaaatgcctgatttttgaccctgaaaaacgggttaaaaaagccggagatctattggca
ttattagaaaaacgaactgcggcatcaccgcccccggcttcccccgaaccgccgcgcgtt
gagtcttcctatggcgggaaaacaaagattcatgaatcgcccgctgaccctcccaaaccg
tccgggatacatctgaaagaaccgccaataaaaaaagcaccgatcaacgtacgcttcccc
tgggaaatgagcttgctcgtagcctctctgttctttgtgctgtggatcttttattggctg
gctacccgttccaaacaccccgtagaagattcgaaaaaccccgtggcatcctcggccgaa
agcgctgctccggatacgattttaaaaaattcagaaataaaagaacttgtaaagcccgct
gatctacaaggctctgaagaaaaaaagaggcccgtagccgaacctgccaaaaagaaaatt
tcctccaaaagttatttgatcatttacacgacctatcataacctgagagtctacattgat
aacgtacctcaggcggaaattgcgcgaaccggccaaaaaaatgtgtatgagctgccgata
ggggaaggtactttttttaaggtagaatacttggttccgggaagagagtcgggcctgaca
accgaaagtgaccgatttaccgttgtgcccggtcaaaagtatgaagtacgttataccgaa
aagattttctga

DBGET integrated database retrieval system