KEGG   Rhodobacter sphaeroides KD131: RSKD131_0421Help
Entry
RSKD131_0421      CDS       T00844                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00473  D-Alanine metabolism
rsk00550  Peptidoglycan biosynthesis
rsk01100  Metabolic pathways
rsk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rsk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RSKD131_0421
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RSKD131_0421
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    RSKD131_0421
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rsk01011]
    RSKD131_0421
Enzymes [BR:rsk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RSKD131_0421
Peptidoglycan biosynthesis and degradation proteins [BR:rsk01011]
 Precursor biosynthesis
  Amino acid ligase
   RSKD131_0421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACM00281
UniProt: B9KNK3
LinkDB All DBs
Position
1:408428..409312
Genome map
AA seq 294 aa AA seqDB search
MLMGGASTEREVSLSSGHSCSAALRDAGYEVTEVDAGPDLARVLAELSPDAVFNALHGRW
GEDGCVQGLLEWLRIPYTHSGVLASALAMDKARAKEVFAAAGLPVTQSVLATPEEVRARH
ILPPPYVVKPNAEGSSVGVYIVHEDANGPPQLAADMPQNLMVETYVPGRELTVTVMGDRV
LAVTDILSDGWYDYDAKYRPGGSRHIVPADLPAEITEACHDIALRAHRALGCRGISRSDL
RWDESRGLAGLILLETNTQPGMTPTSLSPEQAAHCGYSFPEFCAWLVEDASCSR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtgctgatgggcggggcctcgaccgagcgcgaggtgtcgctgtcgtcgggccattcgtgc
agcgcagccctgcgggacgcaggctatgaggtgacggaggtcgatgccggccccgacctc
gcccgcgtgctggcggagctttcccccgatgccgtcttcaacgcgctccacggccgctgg
ggcgaggatggctgcgtgcagggcctgctcgagtggctgcgcattccctatacccattcc
ggcgtgctggcctcggctctggccatggacaaggcccgcgcgaaggaggtcttcgccgcg
gccgggctgcccgtcacccaaagcgtgctcgccacgcccgaggaggtgcgggcgcgccac
atcctgccgccgccctatgtggtcaagcccaatgccgagggctcttcggtgggcgtctat
atcgtgcacgaggacgccaacggtccgccgcagctcgcggccgacatgccgcaaaacctg
atggtcgagacctatgtccccggccgcgaactgaccgtcaccgtgatgggcgaccgggtg
cttgcggtcaccgatatcctgtccgacggctggtacgattacgacgccaaataccgtccc
ggcggctcgcgtcacatcgtgccggcggacctgccggccgagatcaccgaggcctgccac
gacatcgcactccgcgcccaccgggcgctcggctgccgcggcatctcgcgctcggacctg
cgctgggacgagtcgcgcgggctggcggggctgatcctccttgagaccaacactcagccg
ggcatgacccccacctcgctctcgccggagcaggcggcgcattgcggctattccttcccc
gagttctgcgcctggttggtggaggacgcctcatgcagtcgctga

DBGET integrated database retrieval system