KEGG   Rhodobacter sphaeroides KD131: RSKD131_0486Help
Entry
RSKD131_0486      CDS       T00844                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00250  Alanine, aspartate and glutamate metabolism
rsk00410  beta-Alanine metabolism
rsk00640  Propanoate metabolism
rsk00650  Butanoate metabolism
rsk01100  Metabolic pathways
rsk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RSKD131_0486
   00650 Butanoate metabolism
    RSKD131_0486
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RSKD131_0486
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RSKD131_0486
Enzymes [BR:rsk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     RSKD131_0486
Amino acid related enzymes [BR:rsk01007]
 Aminotransferase (transaminase)
  Class III
   RSKD131_0486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACM00346
UniProt: B9KNR8
LinkDB All DBs
Position
1:complement(476279..477559)
Genome map
AA seq 426 aa AA seqDB search
MMLNADVSRRRTEAVSRGVGMQTQIYADRALNAEIWDIEGRRYIDFAAGIAVVNTGHCHP
KVMAAVAEQMGRFTHTCHQVLPYENYIRLAERLNAAAPGDFAKKTVFVTTGAESVENAIK
IARIHTGRSAVVAFGGGFHGRTFMTMSLTGKVEPYKKGFGTMMPEVYHVPFPQALHGIST
EEAMAALARLFKADLDPGRVAAIIFEPVQGEGGFYPAPPDLVRAIRQLCDAHGIVMIADE
VQTGFARTGTLFAMHGYDVAPDLVTMAKGLGGGLPIAAVTGRAEIMDAAHPGGLGGTYGG
NPLGIAAAHAVLDVIEEENLCARATELGSRLKQKLAEIRATAPEIADIRGPGFMVGAEFA
DPGSKAPDAGFTNRVREEALKRGLILLTCGVHGNVIRFLAPITIPEPHFAEALEILEASV
AAARQG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgatgctgaatgccgacgtaagccgccgccgcaccgaagccgtatcgcgcggcgtgggg
atgcagacccagatctatgccgaccgcgcgctcaatgccgagatctgggacatcgagggg
cgccgctacatcgatttcgcggccggcatcgcggtggtgaacaccggccattgccacccg
aaggtcatggccgcggtcgccgagcagatgggccgcttcacccacacctgccatcaggtg
ctgccctacgagaattacatccgcctcgccgagcggctgaatgccgcggcgccgggcgac
ttcgccaagaagacggtcttcgtcaccaccggcgccgaatcggtcgagaatgcgatcaag
atcgcgcgcatccacaccgggcgctcggccgtcgtggcctttggcggcggcttccacggc
cgcaccttcatgaccatgtcgctcaccggcaaggtcgagccctacaagaagggcttcggc
acgatgatgcccgaggtctaccacgtccccttcccgcaggcgctgcacggcatctcgacc
gaggaggcgatggccgccctcgcccggctcttcaaggccgacctcgacccgggccgcgtg
gccgcgatcatcttcgagccggtgcagggcgagggcggcttctatcccgcgccgccggat
ctggtgcgggcgatccggcagctctgcgatgcgcacgggatcgtcatgatcgccgacgag
gtgcagacgggcttcgcgcgcaccggcacgctctttgccatgcacggctatgacgtggcg
cccgacctcgtcaccatggccaaggggctgggcgggggcctgcccatcgccgcggtgacg
gggcgggccgagatcatggacgcggcccatccgggcggcctcggcggcacctacggcggc
aacccgctgggcatcgccgcggcccatgcggtgctcgacgtgatcgaggaggagaacctc
tgcgcccgcgcgaccgagctcggcagccggctgaagcagaagctggccgagatccgggcc
acggcgcccgagatcgccgacatccgcggcccgggcttcatggtgggcgcggaatttgcc
gatcccggctcgaaggcgcccgacgcgggcttcaccaaccgggtgcgcgaggaggcgctg
aagcgcgggctgatcctgctcacctgcggtgttcatggcaacgtgatccgcttcctcgcg
ccgatcaccatccccgagccgcatttcgccgaagcgctggagatcctcgaagcctcggtc
gcagcggcccggcagggctga

DBGET integrated database retrieval system