KEGG   Rhodobacter sphaeroides KD131: RSKD131_0761Help
Entry
RSKD131_0761      CDS       T00844                                 

Definition
(GenBank) Trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00500  Starch and sucrose metabolism
rsk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RSKD131_0761
Enzymes [BR:rsk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     RSKD131_0761
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     RSKD131_0761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ACM00621
UniProt: B9KQB4
LinkDB All DBs
Position
1:762031..765339
Genome map
AA seq 1102 aa AA seqDB search
MNQNVSPSTVAVRRTDGIDRSQTDWYKDAIIYQLHIKAFQDANGDGIGDFAGLMQRLDYV
QALGVTAIWLLPFYPSPLRDDGYDISDYRSINPSYGAMRDFKLFVQEAHKRGLRVITELV
INHTSDQHPWFQRARRAKKGSAARDWYVWSDTDQKFPETRIIFLDTEKSNWTWDPVAGAY
YWHRFYSHQPDLNFDNPRVLEEVLKIMRMWLEMGVDGLRLDAIPYLVEREGTNNENLPET
HDVLKKIRANLDQHFPDRMLLAEANQWPEDTRPYFGEGDECHMGFHFPLMPRMYMALAQA
DRHPITDIIRQTPEIPEGCQWGIFLRNHDELTLEMVTAEERDYMWRFYAEDSRARINLGI
RRRLAPLMKNDRRKIELLNQMLMSMPGTPIVYYGDEIGMGDNYYLGDRDGVRTPMQWSAD
RNGGFSRCNPQQLYLPTILDPVYGHQAINVEAQAADPSSLLNWTRRLIAVRKQHPAFGRG
SMSLLYPRNRKVLAYVRSHEGTDILCVANLSDTAQAVELDLGRFRGAVPVELTGRSEFPP
VGDLPYMLTLPPYGFYWFILSDQQALPSWHQPMPETLPDFITLTTRDGRAETALTGRETR
QLEADVLPNWLPLQRWFGAKEEKISAVKLAVLGSLSADHALVRLEADVGGEVQQYFLPAS
ALWGEEQLRAGAPKLSFTLAKVRRGPQVGALIDGAYDEQMAQAMLEALRDGRRLSGAGGE
VVFEPGSGLAEIADPGEPRYLGAEQSNISIAFGDRLILKLYRRLRAGEQPDVEVARFLTE
VAGYTHTPRYLGVVSLRPAEGEATVLAAAFAFVANMGDAWRGLFDALVRDLGEFGGWSTA
EAPEVEKDGFSFPLTIPGLLGQRTAELHQAFATETDEAAFRMAPLAAEHLTGWVEGARRE
AEAMLSVLERQRTHLPDEVLPLAEALLARREDLLARLDRVTGFEPSGALTRIHGDYHLGQ
VLLAQDDVAIIDFEGEPRRTLAERREKSSPLRDVAGMLRSFDYAAAAALARHEESFGPAS
ERAVERAEAWRQQAVADFLAAYEGASAGTASLPSDPALKEALLDLFLVQKAVYETSYELG
SRPAWVGIPLRGLLELLDRKPA
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagaacgtctctccctctaccgttgccgtccgccgcacggacggcatcgatcgc
agccagaccgactggtacaaggatgcgatcatctatcagctgcacatcaaggcgtttcag
gacgccaatggcgacgggatcggcgatttcgcgggcctgatgcagcggctggattatgtg
caggcgctgggcgtgaccgcgatctggctgctgccgttctatccctcgccgctccgcgac
gacggctacgacatctcggactatcgctcgatcaacccgtcctacggcgcgatgcgcgac
ttcaagctgttcgtgcaggaggcgcacaagcgcggcctgcgcgtcatcaccgagctcgtc
atcaaccacacctccgaccagcacccgtggttccagcgggcccggcgggcgaagaagggc
tcggccgcgcgcgactggtatgtctggagcgacaccgaccagaaattccccgaaacgcgg
atcatcttcctcgatacggaaaagtcgaactggacctgggatccggtggcgggcgcctat
tactggcaccgcttctattcgcatcagcccgacctgaacttcgacaatccccgcgtgctc
gaggaagtgctcaagatcatgcgcatgtggctcgagatgggcgtcgacgggctcaggctc
gatgcgatcccctatctggtcgagcgcgagggcaccaacaacgagaacctccccgagacg
cacgatgttctaaagaagatccgggccaacctcgaccagcatttccccgacaggatgctg
ctcgccgaggcgaaccagtggccggaggacacgcgcccctatttcggcgagggcgacgaa
tgccacatgggcttccatttcccgctgatgccgcggatgtacatggcgctggcgcaggcc
gaccggcatccgatcaccgacatcatccgtcagacgcccgagatcccggaaggttgccag
tggggcatcttcctccggaaccacgacgagctgacgctcgagatggtcacggccgaagag
cgtgactacatgtggcgcttctatgccgaggattcgcgggcgcggatcaatctcggcatc
cggcgcaggctagcgccgctgatgaagaacgaccggcgcaagatcgagcttctgaaccag
atgctgatgtcgatgccgggcacgcccatcgtctattacggcgacgagatcggcatgggc
gacaactactatctcggcgaccgggatggcgtgcggacgcccatgcaatggtcggccgac
cgcaacggcggcttctcgcgctgcaatccgcagcagctttacctgccgaccatcctcgac
ccggtctacggccatcaggcgatcaacgtcgaggcgcaggcggcggacccgtcgtcgctt
ctgaactggacgcgccgcctgatcgcggtgcgcaaacagcatccggccttcgggcgcggc
tcgatgagcctgctctatccgcgcaaccgcaaggtgctggcctatgtgcgcagccacgag
ggcacggacatcctctgcgtggcgaacctctcggacacggcgcaggcggtcgaactggat
ctcgggcggttccgcggcgcggtgccggtcgagctcacgggccggtcggagtttccgccg
gtgggcgatctgccctacatgctgacgctgccgccctacggcttctactggttcatcctc
tccgaccagcaggcgctgccgagctggcaccagccgatgcccgagacgctgccggatttc
atcaccctcaccacgcgcgacgggcgggccgagacggcgctcaccgggcgcgagacgcgc
cagctcgaggccgacgttctgccgaactggctgccgctgcaacgctggttcggcgccaag
gaagaaaagatcagcgcggtgaaactggccgttctgggctcgctatcggccgatcatgcc
ctcgtccggctcgaggccgatgtgggcggcgaggtgcagcaatatttcctgcccgcctcc
gcgctctggggcgaggagcagctccgggccggggcgcccaagctgagcttcacgctggcc
aaggtccggcgcgggccgcaggtgggcgcgctcatcgacggggcctatgacgagcagatg
gcgcaggcgatgctcgaggcgctgcgcgacggtcgcagactgtcgggtgccgggggcgag
gtggtgttcgagccgggctcgggactggccgagatcgccgacccgggcgagccgcgctat
ctcggggccgagcagtcgaacatctcgatcgccttcggcgaccgcctgatcctcaagctc
tatcgccgcctccgggcgggcgagcagccggacgtcgaggtggcgcgcttcctgacggaa
gtggcgggctacacccatacgccccgctatctgggcgtcgtgagcctgcgtcccgcggag
ggcgaggcgaccgtcctcgccgcggccttcgccttcgtggccaacatgggcgacgcctgg
cgcgggcttttcgatgcgctggtgcgggatctgggcgagttcggcggctggagcacggcc
gaggcgccggaagtggagaaggacggcttctccttcccgctgaccattccgggcctcctc
ggccagcgcacggccgagctgcatcaggccttcgccaccgagacggacgaggcggccttc
cggatggcgccgctcgcggccgagcatctgaccggctgggtcgagggggcgcggcgcgag
gccgaggccatgctgtcggtgctcgaacggcagcggacgcacctgcccgacgaggtgctg
cccctggccgaggcgctgctcgcgcggcgcgaagacctgctggcgcggctcgaccgcgtc
accggattcgaaccctcgggtgccctcacccgcatccatggcgactaccatctggggcag
gtgctgcttgcgcaggacgatgtcgccatcatcgacttcgagggcgaaccgcgccgcacg
cttgcagagcgtcgcgagaagtcctcgccgctccgcgacgtggcggggatgctgcgctcg
ttcgactatgccgccgccgccgccctcgcacgccacgaggaaagcttcggcccggcgagc
gagcgggcggtggagcgggccgaggcctggcggcaacaggcggtggccgatttccttgcc
gcttacgagggcgcctccgcgggcaccgcgagcctgccctccgatccggcgctgaaggag
gcgctgctcgatctcttcctcgtgcagaaggcggtctacgagacctcctacgaactgggc
agccgtcccgcctgggtcggcatcccgctgcgcgggcttctggaactgctggacaggaaa
cctgcatga

DBGET integrated database retrieval system