KEGG   Rhodobacter sphaeroides KD131: RSKD131_0984Help
Entry
RSKD131_0984      CDS       T00844                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00564  Glycerophospholipid metabolism
rsk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RSKD131_0984
Enzymes [BR:rsk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     RSKD131_0984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 Pyr_redox Pyr_redox_2 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ACM00844
UniProt: B9KRQ2
LinkDB All DBs
Position
1:complement(989189..990787)
Genome map
AA seq 532 aa AA seqDB search
MAERGTGSDPVDLFIIGGGINGCGIARDAAGRGLSVTLTEMGDLAQATSSASTKLFHGGL
RYLEYFEFRLVREALEERETLLVAMPHISWPMRFVLPWQPEMRFAGDTPTARLLGRLMPW
ARGRRPAWLIRLALETYDRLGGRKILPPARSVDLTRDPAGRALQPRFTKGWEYSDCWVED
SRLVVLNARDAEIRGATILTRTKVIGAERRGDLWHVTTEGARGRQVHRARALVNAGGPWV
ARIIRETLALPTTEGVRLVRGSHIVTKRLFDHDRCYFFQGTDGRIIFAIPYETDFTLIGT
TDQDHRGAPDEARCTPEEQDYLCAFASDYFRKPVTREDIVWTYSGVRPLHDDGARSATAA
TRDYVLSLDSRGAPLLNVFGGKITTYRRLAESAMAKLAERFPQAGGAWTARVPLPGGDFP
WDGAPALAEGLRRDYPFLTERWAMRLVRAYGTDARNLLGTARSALDLGRDFGATLTEAEV
RWLMDHEYAERAEDVVWRRSKLGLRLTPEQVAALDGWMKDAGGAMEARADTG
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagcgggggaccggaagcgatccggtcgatctcttcatcatcggcggcgggatc
aacggctgcgggatcgcccgcgatgccgccggccgcgggctgagcgtgacgctcaccgag
atgggcgatctcgcgcaggccacctcctcggcctcgacgaagctctttcacggcgggctg
cgctatctcgaatatttcgagtttcgcctcgtgcgcgaggcgctggaagagcgcgagacg
ctgctcgtcgccatgccgcacatctcctggccgatgcgcttcgttctgccctggcagccg
gagatgcgctttgcgggcgacacgcccaccgcgcggctcctcggccggctgatgccctgg
gcccgcggccgccgcccggcctggctcatccggctcgcgctcgagacctacgaccggctg
ggcgggcgcaagatcctgccgccggcgcgctccgtcgatctgacccgcgatccggcgggc
cgtgcgctgcagccgcgcttcaccaagggctgggaatattccgactgctgggtcgaggat
tcgcgcctcgtggtgctgaacgcccgcgacgccgagatccgcggcgccacgatcctgact
cggacgaaggtgatcggggccgagcggcggggcgatctgtggcatgtgacgaccgagggg
gcgcgcgggcggcaggtgcatcgcgcccgcgccctcgtcaatgcgggcgggccgtgggtc
gcgcggatcatccgcgagacgctggccctgcccacgaccgagggcgtgcgcctcgtgcgc
ggcagccacatcgtgacgaagcggctcttcgaccatgaccgctgctatttcttccagggg
acggacgggcggatcatcttcgccatcccctacgagaccgatttcaccctgatcggcacc
accgatcaggaccatcgcggcgccccggacgaggcacgctgcacgccggaagagcaggac
tatctctgcgccttcgcctcggactatttccgcaagcccgtcacgcgcgaggacatcgtc
tggacctattccggggtccggccgcttcatgacgacggggcgcgctcggccacggcggcg
acgcgggactatgtgctgtcgctcgacagccggggcgcgccgcttctgaacgtgttcggg
ggcaagatcaccacctatcggcggctggccgaaagcgcgatggccaagctcgcggagcgt
ttcccgcaggccgggggcgcctggacggcccgggtgccgctgcccggaggagacttcccc
tgggacggggcgcctgcgctggccgaggggctgcggcgcgactatccgttcctcaccgaa
cgctgggcgatgcggctcgtgcgggcctacgggacggacgcgcgaaatctgctcggcacg
gcgcgcagcgcgcttgatctgggacgggacttcggtgctaccctcaccgaggccgaagtg
cgctggctgatggatcacgaatatgccgagcgggccgaggatgtggtctggcggcgcagc
aagctgggcctgcggctcacgccggaacaggtcgcggcgctcgatggctggatgaaggat
gcgggcggggcgatggaagcccgcgccgacacgggctga

DBGET integrated database retrieval system