KEGG   Rhodobacter sphaeroides KD131: RSKD131_2269Help
Entry
RSKD131_2269      CDS       T00844                                 

Definition
(GenBank) Glutathione S-transferase, N-terminal domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rsk  Rhodobacter sphaeroides KD131
Pathway
rsk00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rsk00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RSKD131_2269
Enzymes [BR:rsk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RSKD131_2269
Transporters [BR:rsk02000]
 Other Transporters
  Pores ion channels [TC:1]
   RSKD131_2269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C
Motif
Other DBs
NCBI-ProteinID: ACM02129
UniProt: B9KMN8
LinkDB All DBs
Position
1:2301448..2302065
Genome map
AA seq 205 aa AA seqDB search
MDRLTLYTNPRSRGRIARWMLEEVGQPYDLVTMDYGPEMHTPDYLALNPMGKVPTVTHGS
RVITETAAICAYLADAFPEAGLVPENRASYYRWLFFAAGPFEAAVIDRALGVQIPPERTV
MVGYGDFDRAVATLEHAVSDTPFIAGERFSAADVQVGSQIGWGLQFGTIPDRPAFRAYWE
RLADRPARVRAAAMDDALMAGASHG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggacaggctcacgctctatacgaacccccgctcgcgcggacgcatcgcgcgctggatg
ctcgaggaggtcggccagccctacgacctcgtgacgatggactacggccccgagatgcat
acgcccgactatctggcgctcaatccgatgggcaaggttcccaccgtcacgcacgggtcg
cgggtcatcaccgagacggccgcgatctgcgcctatctcgccgacgccttccccgaagcc
gggctcgtgcccgagaaccgggcctcctactaccgctggctcttcttcgccgcgggcccc
ttcgaggcggcggtgatcgaccgggcgctcggggtgcagatccctccggagcggaccgtg
atggtgggctacggcgacttcgaccgggccgtggccacgctcgagcacgcggtctcggat
acgcccttcatcgccggcgagcggttcagcgcggccgatgtgcaggtcggctcccagatc
ggctgggggctccagttcggcacgatccccgaccggccggccttccgcgcctactgggag
cggctggccgaccgcccggcacgggtacgggcggcagccatggacgatgcgctgatggcc
ggggcctcccatggctga

DBGET integrated database retrieval system